Frederiksenia canicola: A4G17_04590 Help Entry A4G17_04590       CDS       T06481                                  Name (GenBank) acetolactate synthase   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism fcl  Frederiksenia canicola Pathway fcl00290   Valine, leucine and isoleucine biosynthesis fcl00650   Butanoate metabolism fcl00660   C5-Branched dibasic acid metabolism fcl00770   Pantothenate and CoA biosynthesis fcl01100   Metabolic pathways fcl01110   Biosynthesis of secondary metabolites fcl01210   2-Oxocarboxylic acid metabolism fcl01230   Biosynthesis of amino acids Module fcl_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine fcl_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:fcl00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     A4G17_04590    00660 C5-Branched dibasic acid metabolism     A4G17_04590   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     A4G17_04590   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     A4G17_04590 Enzymes [BR:fcl01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      A4G17_04590 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 ACT_4 ACT_AHAS_ss P3A bHLH-TF_ACT-like_plant PHA01746 Motif Other DBs NCBI-ProteinID:  QIM64763 UniProt:  A0AAE6X532 LinkDB All DBs Position 940722..940940 Genome browser AA seq 72 aa AA seqDB search MQTYDLTIQASQRPETLERLLRVIRHRGFTVVQLNAKSDGRVISLQVQVQSERELPLLMH QLVKLPDVIDVK NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgcaaacgtacgatttaactattcaagccagccaacgccctgaaacgttagagcgttta ttacgtgtgattcgccatcgaggcttcactgtggtgcaacttaatgcaaaaagcgatggt agagtaatttcgcttcaagtacaggtgcaaagcgagcgagaactgccgctactaatgcat cagctagtcaaactgcccgatgtgattgacgtgaaataa

DBGET integrated database retrieval system