Fructilactobacillus cliffordii: M3M38_03655 Help Entry M3M38_03655       CDS       T08843                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism fcli  Fructilactobacillus cliffordii Pathway fcli01100   Metabolic pathways fcli01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:fcli00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     M3M38_03655    00074 Mycolic acid biosynthesis     M3M38_03655   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     M3M38_03655 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding SlpA_D2 DUF1493 DUF1953 Motif Other DBs NCBI-ProteinID:  USS87160 LinkDB All DBs Position complement(714778..715035) Genome browser AA seq 85 aa AA seqDB search MAEQANKEQILAEIKDIVVDQTDIDSDKITLDANFKDNLDLDSLDIFEIVDALEDKYDIE IDGDEGMETVQDLVDYVAKQLDEQK NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggcagaacaagcaaataaggaacaaattttagcagaaatcaaagacattgtggtggat caaacggatattgattctgacaaaatcacgttagacgcaaatttcaaagataacttggac ttagatagtttggatatctttgaaatcgtggatgccttagaagacaagtatgacatcgaa atcgatggtgacgaaggcatggaaacggtgcaagatttagttgattacgttgctaaacaa ctagacgaacaaaaataa

DBGET integrated database retrieval system