Flavobacterium commune: BIW12_01640 Help Entry BIW12_01640       CDS       T05006                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism fcm  Flavobacterium commune Brite KEGG Orthology (KO) [BR:fcm00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:fcm03032]     BIW12_01640    03036 Chromosome and associated proteins [BR:fcm03036]     BIW12_01640    03400 DNA repair and recombination proteins [BR:fcm03400]     BIW12_01640 DNA replication proteins [BR:fcm03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     BIW12_01640 Chromosome and associated proteins [BR:fcm03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     BIW12_01640 DNA repair and recombination proteins [BR:fcm03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       BIW12_01640 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  AOZ98243 UniProt:  A0A1D9P6V2 LinkDB All DBs Position complement(403056..403328) Genome browser AA seq 90 aa AA seqDB search MNKSELIDAIAADAGITKAAAKLALESFLGNVGGTLKKGGKVSLVGFGSWSVSPRAARDG RNPQTGKTIQIAAKNVVKFKAGAELEGAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaatcagaattaatcgatgctatcgctgctgacgcaggaattactaaagctgct gcaaaattagctttagaatcatttttaggtaatgtaggtggtaccttgaaaaaaggtgga aaagtatctcttgtaggtttcggatcatggtcagtttctccaagagctgctagagacgga agaaatcctcaaactggaaaaacaattcaaatcgctgctaaaaacgttgtgaaattcaaa gctggagctgaattagaaggagctgtaaactaa

DBGET integrated database retrieval system