Fructilactobacillus carniphilus: M3M37_05365 Help Entry M3M37_05365       CDS       T08865                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism fcp  Fructilactobacillus carniphilus Pathway fcp01100   Metabolic pathways fcp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:fcp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     M3M37_05365    00074 Mycolic acid biosynthesis     M3M37_05365   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     M3M37_05365 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 PP-binding_2 SlpA_D2 DUF1953 Motif Other DBs NCBI-ProteinID:  USS90272 LinkDB All DBs Position complement(1049112..1049369) Genome browser AA seq 85 aa AA seqDB search MAEQANKEQILAEIKDIVVDQTDIDPNKITLDANFKDNLDLDSLDIFEIVDALEDKYDIE IDGDEGMETVQDLVDYVAKQLDEQK NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggcagaacaagcaaataaggaacaaattttagcagaaatcaaagacattgtggtggat caaacggatatcgatcctaacaaaattacgttagacgcgaacttcaaagataacttggac ttagacagtttggatatctttgaaatcgtggatgccctagaagacaaatatgacatcgaa attgatggcgacgaaggcatggaaacggtgcaggatttagttgattacgttgctaaacaa ctagacgaacaaaaataa

DBGET integrated database retrieval system