Flavobacterium covae: AWN65_08905 Help Entry AWN65_08905       CDS       T08038                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism fcv  Flavobacterium covae Brite KEGG Orthology (KO) [BR:fcv00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:fcv03032]     AWN65_08905    03036 Chromosome and associated proteins [BR:fcv03036]     AWN65_08905    03400 DNA repair and recombination proteins [BR:fcv03400]     AWN65_08905 DNA replication proteins [BR:fcv03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     AWN65_08905 Chromosome and associated proteins [BR:fcv03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     AWN65_08905 DNA repair and recombination proteins [BR:fcv03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       AWN65_08905 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-DNA_bdg Nup214_FG HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  AMA49569 UniProt:  A0A109Q5Q8 LinkDB All DBs Position complement(2000032..2000307) Genome browser AA seq 91 aa AA seqDB search MNKSDLIDAMAADAGITKAAAKAALESFLSNVEGTLSKGGKVALVGFGSWSVSTRAAREG RNPQTGNTIKIEAKNVVKFKAGAELEGAVNK NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaacaaatcagatttaatcgatgctatggctgctgatgcaggaattactaaagctgct gcaaaggctgcattagagtcatttttaagtaatgttgaaggaactttaagtaaaggtggt aaagttgctttagtaggattcggatcatggtcagtatctacaagagcggctagagaagga agaaaccctcaaacaggaaatactattaaaattgaagctaaaaatgtagtgaaatttaaa gcaggagcagaattagaaggagctgttaataaataa

DBGET integrated database retrieval system