Faecalibacterium duncaniae JCM 31915: GXM22_12735 Help Entry GXM22_12735       CDS       T08154                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism fdu  Faecalibacterium duncaniae JCM 31915 Pathway fdu01100   Metabolic pathways fdu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:fdu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GXM22_12735 (acpP)    00074 Mycolic acid biosynthesis     GXM22_12735 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GXM22_12735 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 PP-binding_2 HMG-CoA_red_N ACP_SdgA_C Ribophorin_II_3rd Motif Other DBs NCBI-ProteinID:  QIA43850 LinkDB All DBs Position complement(2658193..2658420) Genome browser AA seq 75 aa AA seqDB search MTFEEMKKIVVDTLNCEEDKVTMEASLTEDLEADSLDAVELNMALEDACGVSIPDEELAK LKTVGDIYNYITAHI NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgacgtttgaagaaatgaagaagatcgttgttgacaccctgaactgcgaggaggacaag gtgaccatggaggccagcctgaccgaggatctggaggccgacagcctggatgccgtggag ctgaacatggcgctggaggatgcctgcggtgtgtccatcccggacgaggagctggcaaag ctcaagaccgtgggtgacatctacaactacatcaccgcacatatctga

DBGET integrated database retrieval system