Fictibacillus enclensis: QNH15_10960 Help Entry QNH15_10960       CDS       T09077                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism fec  Fictibacillus enclensis Pathway fec01100   Metabolic pathways fec01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:fec00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     QNH15_10960 (acpP)    00074 Mycolic acid biosynthesis     QNH15_10960 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     QNH15_10960 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Guanylate_cyc Flagellin_IN Motif Other DBs NCBI-ProteinID:  WHY74391 LinkDB All DBs Position 2050707..2050943 Genome browser AA seq 78 aa AA seqDB search MADVIERVSKIIVDRLGVDAAEVKPEASFKEDLGADSLDVVELVMELEDEFDLEISDEDA EKITTVGDVVNYINSNNN NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggcagacgtaattgaaagagtttcgaagattatcgtagatcgtcttggtgtagacgct gcagaggttaagcctgaggcttcttttaaagaagatcttggtgcggattccttggatgtt gttgaactagtaatggaactagaggacgaatttgatttggaaatttctgacgaagatgct gaaaaaattacaacggttggagacgttgttaattacataaacagcaacaacaactaa

DBGET integrated database retrieval system