Frateuria edaphi: LQ772_07485 Help Entry LQ772_07485       CDS       T08888                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism fed  Frateuria edaphi Brite KEGG Orthology (KO) [BR:fed00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:fed03032]     LQ772_07485    03036 Chromosome and associated proteins [BR:fed03036]     LQ772_07485    03400 DNA repair and recombination proteins [BR:fed03400]     LQ772_07485 DNA replication proteins [BR:fed03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     LQ772_07485 Chromosome and associated proteins [BR:fed03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     LQ772_07485 DNA repair and recombination proteins [BR:fed03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       LQ772_07485 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_1 HU-CCDC81_bac_2 HU-CCDC81_euk_2 DUF2267 HU-DNA_bdg Arteri_nsp7a SSB Motif Other DBs NCBI-ProteinID:  UGB47118 LinkDB All DBs Position 1564321..1564593 Genome browser AA seq 90 aa AA seqDB search MNKTDLINAVAEKAELTKADAGRALEAFFETVQKALKKGDDVSVVGFGTFTVRKRAARTG RNPRTNETIKIKASKVPAFKAGKTLKDALN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaataaaaccgatctgatcaatgccgtcgccgaaaaggccgagctgaccaaggccgac gccggccgtgccctcgaagcgttcttcgagacggtgcagaaggcgctgaagaagggcgac gatgtgtcggtcgtcggcttcggcacgttcaccgtgcgcaagcgcgccgctcgcaccggt cgcaacccgcgcaccaacgagacgatcaagatcaaggcttccaaggtgccggcgttcaag gctggcaagacgctcaaggatgccctaaactga

DBGET integrated database retrieval system