Ferrovibrio terrae: FNB15_08675 Help Entry FNB15_08675       CDS       T06089                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism fer  Ferrovibrio terrae Pathway fer00190   Oxidative phosphorylation fer01100   Metabolic pathways Module fer_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:fer00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     FNB15_08675  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:fer00194]     FNB15_08675 Photosynthesis proteins [BR:fer00194]  Photosystem and electron transport system   F-type ATPase [OT]    FNB15_08675 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  QDO97334 UniProt:  A0A516H0N6 LinkDB All DBs Position 1767814..1768038 Genome browser AA seq 74 aa AA seqDB search MDLASAKMIGAGIAAIGMGGAAIGVGLIFANFLNGALRNPGAAPKLFGNLMLGFAVTEAL GIFALLIALLILFV NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggatcttgcttcagccaagatgatcggtgccggcattgctgctatcggcatgggcggc gccgcgatcggcgtgggtctgatcttcgcgaacttcctcaacggcgcgctgcgcaatccg ggcgctgccccgaagctgttcggcaacctgatgctcggcttcgcggtgaccgaagcgctc ggcatcttcgcgctgctgatcgcgctgctgatcctgttcgtctga

DBGET integrated database retrieval system