Ferrovibrio terrae: FNB15_16515 Help Entry FNB15_16515       CDS       T06089                                  Symbol rpiB Name (GenBank) ribose 5-phosphate isomerase B   KO K01808   ribose 5-phosphate isomerase B [EC:5.3.1.6] Organism fer  Ferrovibrio terrae Pathway fer00030   Pentose phosphate pathway fer00051   Fructose and mannose metabolism fer00710   Carbon fixation by Calvin cycle fer01100   Metabolic pathways fer01110   Biosynthesis of secondary metabolites fer01120   Microbial metabolism in diverse environments fer01200   Carbon metabolism fer01230   Biosynthesis of amino acids Module fer_M00007   Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P Brite KEGG Orthology (KO) [BR:fer00001]  09100 Metabolism   09101 Carbohydrate metabolism    00030 Pentose phosphate pathway     FNB15_16515 (rpiB)    00051 Fructose and mannose metabolism     FNB15_16515 (rpiB)   09102 Energy metabolism    00710 Carbon fixation by Calvin cycle     FNB15_16515 (rpiB) Enzymes [BR:fer01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.1  Interconverting aldoses and ketoses, and related compounds     5.3.1.6  ribose-5-phosphate isomerase      FNB15_16515 (rpiB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LacAB_rpiB Motif Other DBs NCBI-ProteinID:  QDO98779 UniProt:  A0A516H4T2 LinkDB All DBs Position 3384682..3385125 Genome browser AA seq 147 aa AA seqDB search MSKPTVALAADHAGFELKNLLRDELKAEGYDVLDLGTNSSDSVDYPDFGRQLGQTVAAGK AAFGVAVCGSGIGISIAANRVTGCRAALVHDATSARLCREHNDANVLALGARLIGIETAR DCLKAFLATPFAGGRHQRRVDKLDQPA NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atgtccaagcccacggtcgctctcgctgccgatcatgccggttttgagttgaaaaacctg ctgcgcgatgagcttaaggccgagggctatgacgtactcgacctcggcaccaattcttcc gacagcgtcgattaccccgatttcggccgccagcttggccagaccgtggccgctggcaag gccgcctttggcgttgccgtctgcggcagcggcattggcatctcgattgccgccaaccgc gtcaccggttgccgcgctgccctggtgcacgatgccaccagcgcccggctctgccgcgag cataacgatgccaatgtgctggcgcttggcgctcgcctgatcggcatcgagaccgcgcgc gactgcctcaaggcttttctcgccaccccattcgccggcggccgccatcagcgccgcgtc gacaagctcgaccagccggcctga

DBGET integrated database retrieval system