Formica exsecta (narrow-headed ant): 115241818 Help Entry 115241818         CDS       T07422                                  Name (RefSeq) dynein light chain Tctex-type   KO K10420   dynein light chain Tctex-type 1/3 Organism fex  Formica exsecta (narrow-headed ant) Pathway fex04814   Motor proteins Brite KEGG Orthology (KO) [BR:fex00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     115241818  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:fex03037]     115241818    04812 Cytoskeleton proteins [BR:fex04812]     115241818 Cilium and associated proteins [BR:fex03037]  Motile cilia and associated proteins   Dynein arm    115241818 Cytoskeleton proteins [BR:fex04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      115241818 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 PTP2 DUF7917 Motif Other DBs NCBI-GeneID:  115241818 NCBI-ProteinID:  XP_029673616 LinkDB All DBs Position Unknown AA seq 111 aa AA seqDB search MEDAQEELQFVVDDVSNIIKEAIEVSIGGNAYQHNKVNQWTSNVVEACLGNLTKLQKAYK YIVTCTIMQKNGAGLHTASSCYWDNATDGSCTVRWENKTMYCIVSVFGLAL NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggaggatgcacaagaagagttacaatttgtggtagatgatgtaagtaacattatcaaa gaagcaattgaggtatcaataggaggcaatgcatatcagcataataaagttaatcaatgg acttcaaatgttgtagaggcatgtttaggcaatcttacaaaattacagaaggcttacaaa tatattgtaacttgtacaatcatgcaaaaaaacggagctgggcttcataccgcgagctca tgttactgggataatgctactgatggaagctgtacggtacgttgggaaaataaaactatg tattgcattgtgtccgttttcggactggcgctttag

DBGET integrated database retrieval system