KEGG   Formica exsecta (narrow-headed ant): 115242936
Entry
115242936         CDS       T07422                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
fex  Formica exsecta (narrow-headed ant)
Pathway
fex00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:fex00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    115242936
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:fex00199]
    115242936
Enzymes [BR:fex01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     115242936
Cytochrome P450 [BR:fex00199]
 Cytochrome P450, animal type
  CYP306 family
   115242936
SSDB
Motif
Pfam: p450 Rcd1
Other DBs
NCBI-GeneID: 115242936
NCBI-ProteinID: XP_029675421
LinkDB
Position
Unknown
AA seq 488 aa
MIFLIHIILGISLVFSIYIFRRKRLRLPPGPSGIPLLGYLPWIDSERPHVSLTNLARKYG
PICGLRMGSVYTILLSDPQLVRQAFAKDAFAGRAPLYLTHGIMQGYGIICAQGDLWRDQR
RFVVGCLKNFGMVKLPGTKRDRMEERILTAVSECISKLKDRATEDGIDPLEILHHCVGNL
MNDLVFGKIYEEDDEVWKWLRHLQEEGVKHIGVAGPLNFLPLLRFLPRYGKLMASLIDGK
LKTHQIYQTFIDEHRARLEKTDNILAAFDDVMRSNVNNPGYFTQPQCYHLLADLFGAGTD
TTFTTLRWFLLFMATHPVEQKKIHDEMNELLGQKPASLEDRLVLIRLEAAIAETQRLRSV
TPLGIPHGTIENTQIGDYDVPKGTMVIPLQWAIHTDPSYWHDPLSFKIERFIAEDGSLAK
PKAFLPFQTGKRMCIGDEFAKMILFLFAARILRSFVISVPPGTHIDLEGECGITLIPKPH
RLVFTLRE
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgatattcctcatacatattatcctcggcatttctctcgtattttctatttatattttt
cgtcgtaaaaggcttcgacttccgccgggaccatccggcatcccgctgctcggttatttg
ccatggatagattccgagcgtcctcatgtgtcgctgacaaatctggcgaggaagtatgga
ccgatttgtgggctgcgaatgggctcggtttatacgatcttgctgtcggatcctcagctg
gtaaggcaggcctttgcgaaggatgcatttgccggtagggccccgctatatttaacgcat
ggaataatgcagggatacggcatcatttgcgctcagggtgatctctggagggatcagcga
agattcgtagtcggatgcctgaagaattttggcatggttaagttacccggtaccaagagg
gacagaatggaggaaaggattctcacggccgtgagcgaatgcatatcgaaattaaaagat
cgcgctacggaagacggtatcgatccactggaaatacttcatcattgcgtgggcaatctg
atgaacgatctcgtattcggcaaaatttacgaggaggacgacgaggtgtggaaatggctg
agacatttgcaggaggaaggagtcaagcatatcggagtcgcagggccgctcaacttttta
ccgctcctcagatttttaccacgatatggcaaattaatggcgtcacttatcgatggcaaa
ttgaaaacacatcaaatatatcaaacgtttatcgatgagcatcgtgctcggcttgaaaag
acagataacattcttgcggctttcgacgatgtgatgagaagcaatgtaaacaatcctgga
tactttacgcaacctcaatgttatcatctcttggccgatcttttcggcgcaggcaccgat
acgacctttacaactcttcgatggtttttgcttttcatggcgacgcatccagtcgaacaa
aaaaaaattcacgatgaaatgaacgaactgttgggacaaaagccggccagtttggaggac
agacttgttttaattcgactggaagctgccatcgcggagacacaaagattgcgaagcgtt
acaccgcttggcattcctcatggaacaatagagaacacgcaaataggcgattatgacgta
ccgaaaggcaccatggttattccgttgcagtgggctattcatacggatccttcatactgg
cacgatccgctctctttcaaaatcgaaagatttattgctgaagatggaagtcttgccaag
ccaaaagcttttttgccttttcaaacgggtaaacgtatgtgcatcggtgatgaattcgcc
aagatgatattatttctctttgctgcaaggattcttcgctcatttgttatatcggtgcca
cccggtacacacattgatctagagggcgaatgcggaattactctgattccaaaaccgcat
cggttggtttttacgttgcgggaataa

DBGET integrated database retrieval system