Formica exsecta (narrow-headed ant): 115245191 Help Entry 115245191         CDS       T07422                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism fex  Formica exsecta (narrow-headed ant) Brite KEGG Orthology (KO) [BR:fex00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:fex03041]     115245191   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:fex04052]     115245191 Spliceosome [BR:fex03041]  Complex B   Other components    Complex B specific factors     115245191 Cytokines and neuropeptides [BR:fex04052]  Neuropeptides   Unclassified    115245191 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler OTU1_UBXL Motif Other DBs NCBI-GeneID:  115245191 NCBI-ProteinID:  XP_029679232 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MLEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTHWEKIVLKKWYTIFKDHIKLQDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgttagagataacatgtaacgaccgtctcggtaagaaggttagagtcaaatgcaacccg gacgacaccataggagatctgaaaaaattgatagccgcccagacggggacgcactgggag aagattgtattgaaaaagtggtacaccattttcaaagatcacataaagctgcaagattat gaaatacacgatggcatgaatttagaactctactatcaataa

DBGET integrated database retrieval system