Fervidicoccus fontis: FFONT_1334 Help Entry FFONT_1334        CDS       T01936                                  Name (GenBank) Ribosomal protein S27a   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism ffo  Fervidicoccus fontis Pathway ffo03010   Ribosome Brite KEGG Orthology (KO) [BR:ffo00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     FFONT_1334   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     FFONT_1334  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:ffo03011]     FFONT_1334    04121 Ubiquitin system [BR:ffo04121]     FFONT_1334   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ffo04147]     FFONT_1334 Ribosome [BR:ffo03011]  Ribosomal proteins   Eukaryotes    Small subunit     FFONT_1334   Archaea     FFONT_1334 Ubiquitin system [BR:ffo04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    FFONT_1334 Exosome [BR:ffo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    FFONT_1334   Exosomal proteins of colorectal cancer cells    FFONT_1334 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_IS1595 Auto_anti-p27 Zn_ribbon_RPB9 DUF7479 Cas12f1-like_TNB Phage_zn_bind_2 zf-LITAF-like Med16_C DZR_2 DZR YhfH Zn_ribbon_3 DUF6758 Zn_ribbon_10 Zn_ribbon_13 zf-C2H2_ZN142 Motif Other DBs NCBI-ProteinID:  AFH43322 UniProt:  I0A2W5 LinkDB All DBs Position complement(1270115..1270285) Genome browser AA seq 56 aa AA seqDB search MSQVHNYYEYDYKTKTIKLKNKRCPRCGSIMGHYKEPTERWYCGSCGYTEFLEKKS NT seq 171 nt NT seq  +upstreamnt  +downstreamnt atgtctcaagtgcacaattactatgaatatgattacaagacaaaaactataaagcttaag aacaaaagatgcccgagatgcgggagcataatgggacattataaggaacctactgagaga tggtattgcggctcatgcggatacacggagttcttggagaagaaaagctga

DBGET integrated database retrieval system