Fulvia fulva: CLAFUR5_00287 Help Entry CLAFUR5_00287     CDS       T08195                                  Name (RefSeq) uncharacterized protein   KO K03094   S-phase kinase-associated protein 1 Organism ffu  Fulvia fulva Pathway ffu03083   Polycomb repressive complex ffu04111   Cell cycle - yeast ffu04120   Ubiquitin mediated proteolysis ffu04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ffu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     CLAFUR5_00287    04120 Ubiquitin mediated proteolysis     CLAFUR5_00287   09126 Chromosome    03083 Polycomb repressive complex     CLAFUR5_00287  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     CLAFUR5_00287  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ffu04131]     CLAFUR5_00287    04121 Ubiquitin system [BR:ffu04121]     CLAFUR5_00287    03036 Chromosome and associated proteins [BR:ffu03036]     CLAFUR5_00287 Membrane trafficking [BR:ffu04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     CLAFUR5_00287 Ubiquitin system [BR:ffu04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      CLAFUR5_00287    Cul7 complex      CLAFUR5_00287 Chromosome and associated proteins [BR:ffu03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      CLAFUR5_00287   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      CLAFUR5_00287 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DUF223 Motif Other DBs NCBI-GeneID:  71980165 NCBI-ProteinID:  XP_047755274 UniProt:  A0A9Q8L4Y5 LinkDB All DBs Position 1:join(1308079..1308250,1308304..1308566) Genome browser AA seq 144 aa AA seqDB search MADDDGHEERNPGLRARCGEVWETIDEIIVDTDHDSVAHTHLVYAIHYIQKTLDELREGP VVESNLDPPAPPVSDKEGEDAAGKIYDYAQNAARKSDDASGSKGSEVGDPGPDDFSADDS DDIDMDEPTNGSLEDSGDGLIETK NT seq 435 nt NT seq  +upstreamnt  +downstreamnt atggctgatgacgatggacatgaggagaggaatccgggcctccgtgcgcgctgtggtgag gtttgggagacgatcgatgagatcatcgtcgataccgatcacgacagcgtagcccacacc catctcgtttatgcgattcactatatccagaagaccttggatgagctccgcgaaggtcct gtcgtggagtccaacttggatcctcccgcgccaccagtgtcggacaaggagggtgaagat gctgcaggtaaaatttacgattacgcccaaaatgcggcacgcaaatctgacgatgcctca ggatcaaagggaagtgaggttggagatccgggccctgacgacttctccgcagatgactcc gacgacatcgacatggacgagccgaccaacggctccctggaggatagtggtgacggtctc atcgagacgaagtag

DBGET integrated database retrieval system