KEGG   Fulvia fulva: CLAFUR5_06324
Entry
CLAFUR5_06324     CDS       T08195                                 
Name
(RefSeq) Acetyl-CoA carboxylase
  KO
K11262  acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
ffu  Fulvia fulva
Pathway
ffu00061  Fatty acid biosynthesis
ffu00254  Aflatoxin biosynthesis
ffu00620  Pyruvate metabolism
ffu00640  Propanoate metabolism
ffu01100  Metabolic pathways
ffu01110  Biosynthesis of secondary metabolites
ffu01212  Fatty acid metabolism
Module
ffu_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:ffu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CLAFUR5_06324
   00640 Propanoate metabolism
    CLAFUR5_06324
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CLAFUR5_06324
  09110 Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    CLAFUR5_06324
Enzymes [BR:ffu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     CLAFUR5_06324
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     CLAFUR5_06324
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     CLAFUR5_06324
SSDB
Motif
Pfam: ACC_central Carboxyl_trans CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl Dala_Dala_lig_C GxGYxYP_N ATP-grasp_3 Biotin_lipoyl_2
Other DBs
NCBI-GeneID: 71986202
NCBI-ProteinID: XP_047762711
LinkDB
Position
5:complement(4483873..4490893)
AA seq 2273 aa
MADAVAGAPKTNGHLNGYPSKMAAKYNLAPHFIGGNELSSAAPSKVKDFVAAHDGHTVIT
SVLIANNGIAAVKEIRSVRKWAYETFGDERAIQFTVMATPEDLGANADYIRMADQYVEVP
GGTNNNNYANVELIVDIAERMNVHAVWAGWGHASENPKLPESLAASPKKIVFIGPPGSAM
RSLGDKISSTIVAQHAKVPCIPWSGTGVDHVEVDENNIVTVDDETYAKGCVKSWQEGLES
AKKIGFPVMVKASEGGGGKGIRKVDGEEGFEALYKAAASEIPGSPIFIMKLGANARHLEV
QLLADQYGNNISIFGRDCSVQRRHQKIIEEAPVTIAGQKTFQQMADAAVSLGRLVGYVSA
GTVEYLYSHADDKFYFLELNPRLQVEHPTTEMVSGVNIPAAQLMVAMGIPLNRIRDIRLL
YGADPHTQTDIDFNFEKEGASQLQRRPQPKGHCTACRITSEDPGEGFKPSSGTMHELNFR
SSSNVWGYFSVGAASAIHNFSDSQFGHIFAYGENRQASRKHMVVALKELSIRGDFRTTVE
YLIKLLETPAFEDNTITTGWLDELISKRLTAERPDPMIAVVCGAVTKAHLASEECMGEYK
KGLDKGQVPSKEILKTVFPVEFIYEGSKYKFTATRSSPDTYTLFVNGSKALVGIRALSDG
GLLVLLGGRSHSVYWKEEVGAIRMSVDGKTCLLEQENDPTQLRTPSPGKLVKYAVENGEH
VKKGQAFAEVEVMKMYMPLLAQEDGHVNLIKQPGATLEAGDILGILALDDPTKVKSAQPF
LGQLPEMGTPVVLGTKPPQRFAFLKGVLQAILSGYDNSVIMQQTLKDFIAVLRDPELPYG
EWNAQASALHSRMPQKLDTAFEQLVERAHNRKTEFPAKQLRKTFDRFLADNVSAGDAELL
RTALTPLTDIIAKYEDGLKAHEFAVFIELFDQYWAVESIFSARQSRDEEIVLSLRDANKD
KTANVVQTVLSHTRASAKNSLMVAILDQFRPNRPGVGNVAKYFRPSLQKLADLEGRATAK
VSLKARELLIQCAMPSLEERTSQMEHILRSAVLESRYGESGWDHREPNFEVIKEVVDSKF
TVFDVLPHFFVHQDPWVSLAALEVYTRRAYRAYNLKSLEYLTENDVPYVLAWNFALRKVG
EAEFGLPVASSHPSEPGTPAEGLGRVHSISDMSYIGRQAGAGEPSRRGAVVPVPFIDEAD
EYLMKALEAFPVAAGQKTRADVNTLSADLSKRRAGVTAPQSDEELTAVCNVAVRDSESLD
DKEILSRLIPIVKDYKDELLARRVRRLTFICGHKDGTYPGYYTFRGPTYEEDTQIRHIEP
ALAFQLELGRLSKFNIKPVFTENRNIHMYEAIGKNAESDKRYFTRATVRPGHLREDIPTV
EYMISEADRLMNDILDAMEIAGNNGSDLNHIFINFSTVFPLAPKEVEEALGGFLDRFGRR
AWRLRVTSAEIRLVCTDPDTGKPFPMRVNITNTSGYVIEVELYEERKSERSSEWLFHSIG
GTRKIGSMHLRPVSTPYETKGALQPKRYKAHIMGTQYAYDFPELFRQAIENEWIQTSAQH
PGMKDKQPVKGECIEYNELVLDESDNLAEVNRDPGANNIGMIGWIVTAKTPEYPRGRRFI
IIANDITHKIGSFGPQEDKFFHKCSELARKLGIPRIYLSANSGARIGMAEELIPHFSVAW
KDPSRPEAGFEYLYLTPEKKARFEDGALKHVLTKEINVGGEPRHQITTIVGAEDGLGVEC
LKGSGLIAGETSRAYEDIFTVTLVTCRSVGIGAYLVRLGQRAIQIEGQPIILTGAPAINK
LLGREVYTSNLQLGGTQIMYKNGVSHMTANDDFEGVSKIVRWMSFVPEKKGAPVPISPSA
DTWDREITFFPPQKAPYDVRHLIAGQHTDEGFMSGLFDKDSFEEALGGWARTVVVGRARL
GGIPVGVIGVETRSVENITPADPANPDSIEQVTNEAGGVWYPNSAFKTAQAIKDFNNGEQ
LPLMILANWRGFSGGQRDMYNEVLKYGSYIVDALVKYEQPVFVYIPPFGELRGGSWVVVD
PTINPDFMEMYADEDARGGVLEPEGIVGIKYRKERQLETMARLDQTYGDLKRASLEKGIS
PEKQKEIQAKMHEREQLLLPVYLQISLQYADLHDRAGRMKAKDTIRMPLSWQNARRFFYW
RLRRRLNEEYVLKRIAASQSKELVSRSTSLKTLESWSGLPKYATDDAAVAVWFEENRKTI
ADKIEAMKTDAIAYDVAALMRSHKSGGLKGVAQVLSMLPVDEKEEVLSWLRKA
NT seq 6822 nt   +upstreamnt  +downstreamnt
atggccgacgcagtcgcaggagcgcccaagaccaatggtcacttaaacggctatcctagc
aagatggcagcaaagtacaaccttgcgcctcacttcatcggcggcaacgagctctcgagt
gccgcgcccagcaaagtgaaggacttcgtagccgcacacgatggtcacaccgtcatcacg
agtgtcctgattgccaacaacggtatcgcagcagtcaaggagatccgatcggtacgaaaa
tgggcatacgagacctttggtgacgagcgggccatccagttcaccgtgatggccacgcca
gaagatctgggcgccaatgccgactacatcagaatggctgatcagtacgttgaagtgcca
ggcggcacgaacaacaacaactacgccaacgtggagcttattgtcgatattgcggaacgc
atgaacgtgcatgcagtctgggcaggatggggacacgcctcagagaaccccaaactcccc
gaatcgctcgccgcctcgcccaagaagattgttttcatcggtcctcctggctctgctatg
aggtcgctcggtgacaagatctcctcgacaatcgtcgcacagcacgccaaggtaccatgt
atcccgtggtcaggaactggcgtggaccatgtagaggtggacgagaataacatcgtcact
gttgatgacgagacctatgccaaaggttgcgtgaagtcgtggcaagaaggtctcgagtca
gcaaagaagattggcttcccagtcatggtcaaggcatcagaaggaggtggaggcaagggt
atccgaaaggtcgatggcgaggagggcttcgaggcattatacaaggccgcagccagcgag
atccctggatcgcccatcttcatcatgaagctcggagccaatgccaggcatttggaggtc
cagcttcttgctgaccagtacggcaacaacatttccatcttcggtcgtgactgttccgtg
cagcgaagacatcaaaagattatcgaagaggcgccagtgacgattgcgggacagaagacc
ttccagcagatggctgatgccgctgtgtcgcttggtagattggtcggctacgtttctgct
ggtacagtggagtatctctactcccacgcggacgacaagttctacttcctcgagctgaac
ccccggcttcaagttgagcatccaaccactgagatggtttcgggtgtcaacattccagct
gctcagctcatggtcgccatgggtatcccactcaaccgcatccgtgacattcgtttgctc
tacggcgcggatcctcacacacagactgatatcgactttaacttcgagaaagaaggcgct
tcccagctgcagcgccgaccacagccaaagggacactgcacagcttgccgtattacctcc
gaggacccaggcgagggtttcaagccatcttcaggtacgatgcacgaactgaacttccga
tcgagctcgaacgtctggggatacttctccgtcggtgctgcatctgccatccacaacttc
tccgattcccaattcggtcacatcttcgcatacggcgagaacagacaggcttcccgaaag
cacatggtcgttgcactgaaagagctgagcattcgtggtgacttcaggacaacggtggag
tacctcatcaagctgttggaaactccagctttcgaggacaacaccatcacgaccggatgg
ctcgatgagctgatcagcaagagattgacagccgagcgaccagatcccatgatcgcggtg
gtctgtggtgccgttacgaaagcacacttggccagcgaagagtgcatgggcgaatacaag
aagggcctcgacaagggtcaagttccgagcaaggagatcctgaagacagtcttcccagtg
gagttcatctacgagggcagcaaatacaagttcacggcgacacgatccagcccagacaca
tacacactgtttgtgaacggcagcaaggcgctggtcggcattcgagcactttcggacggc
ggtcttcttgtactccttggaggacgctcgcacagtgtctactggaaagaggaggtcggt
gctatccgaatgtcagtcgatggcaagacctgcttgcttgagcaagagaacgacccaaca
cagcttaggacaccttctccaggaaagctggtcaagtatgctgtcgagaacggagagcac
gtcaagaagggccaggctttcgctgaagtggaggtcatgaagatgtacatgccgctcctc
gctcaagaggatggacatgtcaacctcatcaaacagccaggcgccacgctcgaagccgga
gacatcctcggtatcttggcacttgacgaccctaccaaggtgaagtcggctcagccattc
ttgggccagctgccagagatgggaacgcctgttgtgttgggcacgaagccaccgcagcga
ttcgcattcttgaagggtgtgcttcaggccatcctgtcgggttatgacaactcggtcatc
atgcagcagacactgaaggacttcatcgctgtgctccgcgaccctgagctgccgtacggg
gagtggaacgcgcaagcatcagcgctgcactcacgcatgccgcagaagctagacactgcg
ttcgagcagctcgttgagcgcgcacacaaccgcaagactgagttcccagcgaagcagctc
cgcaagacgttcgaccgcttcttggccgacaatgtctctgcaggcgacgctgagctgcta
cgaactgctctcacaccattgacggacatcatcgccaaatacgaggatggcctcaaggca
cacgagttcgccgtcttcatcgagctctttgaccaatactgggccgtggagagcatattt
tccgcaaggcagagccgcgatgaagagattgtgctatccctacgtgatgccaacaaggac
aagactgcgaacgtcgtgcaaaccgtgctttcgcacactcgagcaagcgcgaagaatagc
ctgatggttgcgatcctcgaccagttcaggccgaaccgtccaggtgttggcaatgttgcc
aagtacttccgtccatccctgcagaagctcgcagacctcgaaggtcgcgctactgccaag
gtgtcgctcaaggcccgtgagctgctcatccagtgcgctatgccatcgcttgaggagcgc
acttctcaaatggagcacatcctgcgctctgctgtcctcgaatccaggtacggcgagagt
ggttgggatcacagagagcccaactttgaggtcatcaaggaagttgtggactccaagttc
acagtctttgatgtgctgccgcacttcttcgtgcaccaggatccatgggtttcccttgcg
gctctggaagtgtacacacgccgcgcataccgtgcgtacaatctcaagtcgcttgagtac
ctcaccgagaacgatgtgccgtacgtccttgcttggaacttcgcccttaggaaggtcgga
gaagccgagtttggtctgccagtggcatcatcgcacccatctgagccaggcacgccggct
gagggtctgggtagagtccactccatcagcgacatgagctacattggtcgccaagctggc
gctggagagcctagccgacgcggtgcagtcgtaccggtgccttttatcgatgaagccgat
gagtacttgatgaaggctctcgaggctttcccagtcgctgctggtcagaagacaagagct
gatgttaacactctcagcgccgacctgtctaagagacgggcgggtgtcactgcaccacag
agtgatgaggagctcactgctgtctgcaacgttgcagtccgcgattcggagtctctcgac
gacaaggaaattctctcccgcctcattcccatcgtcaaggactacaaagacgagcttctc
gctcgtcgcgtgcgacgcctgacattcatttgtggccacaaggatggcacatatcctggc
tactacacattccgtggtcccacttacgaggaagacactcagattcgtcacatcgagcca
gcgcttgccttccagcttgagctcggacgtctctccaagttcaacatcaagccagtcttc
acggagaaccgcaacattcacatgtacgaagccattggcaagaatgctgagagtgacaag
cgttacttcacccgtgctaccgtcaggccaggtcaccttcgcgaggatatcccaactgtt
gagtacatgatctccgaggccgaccgtctcatgaacgacattctcgatgcaatggagatt
gctggcaacaacggatccgatctgaaccacatcttcatcaacttctccaccgtcttccct
cttgcgccaaaggaggtcgaggaggctcttggtggcttcttggaccgtttcggtcgacgc
gcctggagacttcgtgtcactagtgctgagattcgcctggtttgcactgaccccgacact
ggcaagccattccctatgcgtgtcaacatcaccaacacctcaggctacgtcattgaggtc
gagttgtatgaggagcgcaagtccgagaggtcgagcgaatggctgttccacagcattggt
gggactcgcaagattggttccatgcacttacgaccagtgtccactccttacgaaaccaag
ggtgctttgcagccaaagcgttacaaggctcacatcatgggcactcagtacgcttacgat
ttcccagagctctttcgccaagccatcgagaacgaatggatccagaccagtgctcagcac
ccaggcatgaaggataagcagcctgtcaagggcgagtgcattgagtacaacgagctcgtg
cttgatgagtccgacaaccttgctgaagtcaatcgtgacccaggtgccaataacattggt
atgatcggttggattgtgacagccaagaccccagagtaccctcgtggccgtcgcttcatc
atcattgccaacgacatcacccacaagattggttctttcggtcctcaggaagacaagttc
ttccacaagtgctcggagctcgctcgcaagctaggcattccacgcatttacctgtctgcc
aactcgggtgctcgtattggtatggctgaagaactgatcccccacttctccgtcgcctgg
aaggacccaagccgcccggaggctggtttcgaatacctctacctgacaccagagaagaag
gctcgcttcgaagatggcgcccttaagcacgttctcacaaaggagatcaatgtcggcggc
gagccacgtcaccagatcaccaccatcgtcggagctgaggacggcctcggtgtcgagtgt
ctgaagggctccggtcttatcgcaggagagacttcgcgcgcatacgaggacatcttcacc
gtcaccttggtcacttgccgttccgttggtatcggtgcctaccttgtacgccttggtcag
cgtgccatccaaatcgagggtcagccaatcatcctcactggtgcccctgccatcaacaag
ctcttgggtcgtgaggtctacacctccaacttgcagcttggtggcacccagatcatgtac
aaaaacggtgtttctcacatgaccgccaacgatgatttcgaaggtgtttccaagatcgtc
cgatggatgtcgttcgttccagagaagaagggcgcgccagtgccgatctcaccgtctgcc
gacacctgggatcgtgagatcacttttttcccaccacagaaggcgccatacgatgttcgc
cacctcatcgctggtcagcacaccgacgagggtttcatgtctggtctgttcgataaggat
tctttcgaagaagcacttggcggatgggcacgcactgtcgtagttggtcgcgctcgtctt
ggtggcatcccagttggtgtcattggtgttgagacacgatcggtcgagaacatcacccca
gcagatccagccaacccagactctatcgagcaggttaccaacgaagccggtggtgtctgg
taccccaacagtgctttcaagaccgcacaggccatcaaggacttcaacaacggcgagcag
cttccattgatgattctggctaactggagaggtttctctggaggtcaacgtgacatgtac
aacgaagttctcaagtacggttcgtacattgtcgacgccctcgtgaagtacgagcaaccc
gtcttcgtgtatatcccaccattcggcgagcttcgtggcggttcatgggtcgtcgtcgat
ccaactatcaaccccgacttcatggagatgtacgccgatgaggacgctcgcggcggtgtt
ctcgagccagaaggtatcgtcggcatcaagtaccgcaaggaacgccaactcgagaccatg
gctcgtcttgatcagacctacggcgatcttaagcgtgcatcgctcgagaagggcatttca
cccgagaagcaaaaggagatccaggcgaagatgcacgaacgcgagcagctcttgctacca
gtctatctgcaaatctcgctgcagtacgctgacctgcacgaccgagcaggtcgcatgaag
gccaaggacacgatccgcatgccactgtcatggcagaacgcccgccgcttcttctactgg
cgcctgcgccgccgtctcaacgaagagtacgtgctcaagcgcatcgcggcttcccaatcc
aaggagctggtcagcaggtccaccagcctcaagactctcgagtcttggtctggtctaccc
aagtacgccacggacgatgccgcagtcgctgtgtggttcgaagagaaccgcaagaccatc
gccgacaagatcgaggcgatgaagaccgacgcgattgcctacgatgtcgccgccctgatg
cgcagccacaagtctggaggtctcaagggtgttgcacaagttcttagcatgctgcctgtg
gatgagaaggaggaggtgctgtcctggctgcgaaaggcatag

DBGET integrated database retrieval system