KEGG   Fulvia fulva: CLAFUR5_10127
Entry
CLAFUR5_10127     CDS       T08195                                 
Name
(RefSeq) Oxidoreductase aflX
  KO
K24857  oxidoreductase AflX
Organism
ffu  Fulvia fulva
Pathway
ffu00254  Aflatoxin biosynthesis
ffu01100  Metabolic pathways
ffu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ffu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    CLAFUR5_10127
SSDB
Motif
Pfam: NAD_binding_10 NmrA DXP_reductoisom NAD_binding_4 KR Semialdhyde_dh Sacchrp_dh_NADP Epimerase DapB_N
Other DBs
NCBI-GeneID: 71990005
NCBI-ProteinID: XP_047764444
LinkDB
Position
7:1174850..1175611
AA seq 253 aa
MPSYAILGATGNIGRSILEVLLQSPDNHINAYCRFKQKLYKLMPVVKHNKQVDVFEGELS
DINLLARCLIGTTAAFQAVAVDGNQPGCTIAQDTSRRVTTALEHLKANGHRLPKLVVTSS
SSTDHSLLSNVPSFFRNMLYRAFSHTYDDLLAAEKFIRSKDDLISATFVKPGALTSQPQV
GHELSLEVAKSPLSYLDLAAGMIELADDSSERYDMKGVAVNSAVKVPFPRESPMKIFKGL
LCHFFPWLYPYIG
NT seq 762 nt   +upstreamnt  +downstreamnt
atgccttcatacgcaatactgggagccactggcaatatcggcagatcgattctggaagtc
ctccttcaatcgccagacaatcacatcaatgcatactgccgcttcaaacagaaattgtac
aagctaatgccggtcgttaagcacaacaaacaagtcgacgtcttcgaaggcgagctatca
gacatcaaccttctggccaggtgtttgatcggcacaacggcagccttccaagccgtcgct
gtagacggcaaccaaccaggctgcacgatcgctcaagacacttcgcggcgcgttactact
gctctcgaacatctcaaggccaacggacaccgccttccaaagctcgtcgtcacctcctca
tcctccacagaccacagtctgttgtctaatgtcccatccttcttccgcaacatgctatac
cgagctttctcccatacctatgacgacctcctggcggctgagaagtttattcgatccaag
gacgatctgatctcagcgacttttgttaagcctggtgctttgacgagtcagcctcaggtc
ggccatgagttgagtctggaagtggcaaagtcaccgctatcgtatctggatctggcggcg
gggatgatagagctcgccgatgatagcagtgagcggtatgacatgaaaggagttgcagtc
aacagcgcagtcaaggtgccgtttccccgggagtccccgatgaagatcttcaaaggactt
ttgtgtcacttctttccgtggttgtatccctatattggatga

KEGG   Fulvia fulva: CLAFUR5_14279
Entry
CLAFUR5_14279     CDS       T08195                                 
Name
(RefSeq) Oxidoreductase ordB
  KO
K24857  oxidoreductase AflX
Organism
ffu  Fulvia fulva
Pathway
ffu00254  Aflatoxin biosynthesis
ffu01100  Metabolic pathways
ffu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ffu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    CLAFUR5_14279
SSDB
Motif
Pfam: NAD_binding_10 NmrA Semialdhyde_dh 3Beta_HSD Epimerase Polysacc_synt_2 F420_oxidored NAD_binding_4 BRCA2
Other DBs
NCBI-GeneID: 71994157
NCBI-ProteinID: XP_047769485
LinkDB
Position
13:complement(634894..635697)
AA seq 267 aa
MASYAVLGATGNTGQALINILLQSPEKKIHAYCRSKQKLLRLTPQLADNKNVKVSEGSLN
DTSIIADCIRGTRAVFLAVAVPDNMPGMTIAQDTARVTVGALQSIRAGNEKAVLPKVIVL
SSAKLDDNLCQNMPHAMKVLVKLATSNQCADLEESQRILTAERHWISSTFMMPGGLVQDA
QKGHALSLETEKTPLSYLDLAAGMVEVADSGDEYHMKNVSVIPTGTGVKFPYESLLEVVK
GLLAHYFPWTYRYTGAMPMPVLPQKRV
NT seq 804 nt   +upstreamnt  +downstreamnt
atggcttcttacgccgtcctgggggccactggcaacactggccaagccttgatcaacatc
ctgcttcaatccccagagaagaagattcacgcttactgccgctccaagcaaaagctcctt
cgcctcacaccacagctagccgacaacaagaacgtcaaagtctccgaaggaagcctcaat
gatacgtccatcatcgcagactgcatccgcggcacccgggcggtcttcctcgcagttgcg
gtgcccgacaacatgcctggcatgaccatcgcccaagacactgctagagtcacggtcggc
gctctgcaaagtatcagagcaggaaacgagaaagctgtcttgcccaaggttatcgtgctc
tcttctgccaaactcgacgacaatctttgccaaaacatgcctcacgcgatgaaagtcctc
gtcaaactcgccacctccaaccaatgcgcagatctggaagagtcgcagcgcatcctcacc
gccgagcggcattggatctcttcaacgttcatgatgccagggggtctggtccaagatgca
cagaagggacatgcactctcgctcgagaccgagaagacaccgctttcttacctggacctt
gcggcagggatggtggaggtcgcggacagcggggatgagtaccacatgaagaatgtcagt
gtaattcctacagggactggcgttaagttcccttatgagagtctgctggaggtggtgaag
gggttgcttgcgcattactttccttggacttatcgctatactggtgctatgccaatgccg
gttttgccgcaaaagagggtgtaa

KEGG   Fulvia fulva: CLAFUR5_14375
Entry
CLAFUR5_14375     CDS       T08195                                 
Name
(RefSeq) Versicolorin reductase 1
  KO
K24856  NADPH-dependent reductase
Organism
ffu  Fulvia fulva
Pathway
ffu00254  Aflatoxin biosynthesis
ffu01100  Metabolic pathways
ffu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ffu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    CLAFUR5_14375
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase THF_DHG_CYH_C
Other DBs
NCBI-GeneID: 71994253
NCBI-ProteinID: XP_047769347
LinkDB
Position
13:complement(957012..957932)
AA seq 263 aa
MSADNFRLDGKVALVTGSGRGIGAAIAVELGKRGANVVVNYSRAVDEANKVVETVIANGT
KAIAIKADVREIDQVAKMMDQAVEHFGQLDIVSSNAGLVSFGHLKDVTGDEFDRVFRVNT
RGQFFVAREAYRHLSVGGRIILTSSNTASIKGVPKHAIYSGSKGAIDTFVRCMAIDAGDK
KITVNAVAPGAIKTDMYAAVAREYIPGGDKFTDEQVDECAAWLSPLERVGLPADIGRVVC
FLASDAAEWVSGKIIGIDGGAFR
NT seq 792 nt   +upstreamnt  +downstreamnt
atgtctgccgacaacttccgcctcgacggcaaggtcgcccttgtaactggatctggccgc
ggtattggtgccgccatcgcagtcgagctgggcaaacgtggtgcaaacgtcgttgtcaac
tactcacgagctgtcgatgaggccaacaaggttgtcgagaccgtcatcgccaacggcacc
aaggcaatcgccatcaaggccgatgttcgtgagatcgatcaggttgcgaagatgatggat
caggctgttgagcactttggtcaactcgatatcgtctcttcgaatgctggtcttgtgtct
tttggacacttgaaggatgttactggtgatgagttcgaccgtgtcttccgggtcaacacc
cgtggtcaattcttcgtggctcgcgaggcataccgacacctcagcgtcggcggccgcatc
atcctcacatcctccaacaccgcctcaatcaagggcgtacccaagcacgcaatctactcc
ggctccaagggcgccatcgacacattcgtccgctgcatggcaatagatgcaggcgacaaa
aagatcaccgtcaacgcagttgcccccggcgctatcaagactgacatgtacgctgctgtt
gcgcgcgagtacattcccggcggcgacaagttcaccgatgagcaagtcgatgagtgcgcc
gcctggctttctccgctggaacgtgttggcctaccagcagacattggccgtgttgtttgc
ttccttgcgtcggatgctgccgaatgggtcagtgggaagattattggtattgacggtggt
gccttcagatag

DBGET integrated database retrieval system