KEGG   Fulvia fulva: CLAFUR5_14163
Entry
CLAFUR5_14163     CDS       T08195                                 
Name
(RefSeq) Cytochrome P450 monooxygenase cypX
  KO
K24440  averufin monooxygenase [EC:1.14.-.-]
Organism
ffu  Fulvia fulva
Pathway
ffu00254  Aflatoxin biosynthesis
ffu01100  Metabolic pathways
ffu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ffu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    CLAFUR5_14163
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ffu00199]
    CLAFUR5_14163
Enzymes [BR:ffu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     CLAFUR5_14163
Cytochrome P450 [BR:ffu00199]
 Cytochrome P450, fungi type
  CYP62 family
   CLAFUR5_14163
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 71994041
NCBI-ProteinID: XP_047769571
LinkDB
Position
13:complement(248788..250205)
AA seq 454 aa
MVRIGPKEVDVADPAAAREVHRMGTVFTKAPFYRLLSPGPVDNIFNFRDQKKHSQRRKLY
AKGFTLVELRRNWETTINKTIRMAVQKMKEEAANGDTELMGWWTLMANEIVCRLTFNGGH
GTVEKGIKDPFVLMLEKRKGDLAHLLKMFIPPLYYVGRVLGKVNTRMNDIFYSQEKMFKA
GAGVVQSARQDKEAGEFNQNLFAKALQEGEGDAATLTDTDIMTDAGALLLAGSDPTAISL
TFLVYLVLSRPELQKQLEEEVASIDGEVTDTACEGLPLMNAVIDESMRLYGAAPGGLPRS
PAAGGAKLGGYYMPEGTVVDTQNRSLHTDEGTWKDGQAFDHTRFLPENRLEFSAHQKMAF
NPFGQGSRQCLGIHLGKLEMRLAVAHFFRELRGAKLAKSATPESMAVVDSFVAGVPRERK
CEVTMKARSDAHVIGVLEPREKRPSSSSGSFTQD
NT seq 1365 nt   +upstreamnt  +downstreamnt
atggtccggattggccccaaggaagtggacgtggctgacccagcggcggcacgagaagtc
catcgcatgggcactgtattcaccaaggcaccgttctaccgtctcctgtccccaggtcca
gtcgataacatcttcaacttccgcgaccagaagaagcacagccagcgtcgcaagctatac
gccaagggctttactttggtcgagttgcggaggaattgggaaaccacgatcaacaagacc
atccgcatggctgtacagaaaatgaaggaagaagctgccaacggcgacacagagctcatg
ggctggtggacgttgatggccaacgagattgtctgccgcttgaccttcaacggtggccac
ggaactgtcgaaaagggtatcaaagatccattcgtcctcatgctcgagaagcgtaaaggc
gatcttgcgcatctcctcaagatgttcatccctcctctttactacgtcggccgtgtgctt
ggaaaggtcaacacgcgcatgaacgacatcttctactcgcaggagaagatgttcaaggct
ggtgctggcgtcgtccagagtgctcgtcaggacaaggaggctggcgagttcaaccagaac
ttgttcgcgaaggcgctgcaggaaggcgagggcgatgccgcgacattgactgacaccgac
atcatgaccgatgctggcgcactgctgttggcgggctccgacccgactgccatctcgctg
acgttcctggtctacctcgtgctgagcaggcccgagctccagaagcagctggaggaggaa
gtcgcatcgatcgatggcgaagtgactgatacggcgtgtgaaggtctgccactcatgaac
gcggtcattgacgagagcatgcgcctgtatggtgccgctccgggaggtcttcctcgtagc
ccagcggccggaggtgccaagctgggtgggtactacatgcccgaaggcactgtcgtcgat
acgcagaaccggtctctacacacggatgaaggcacgtggaaggatggccaggcattcgac
cacactcgcttcctgccagagaacaggctggagttctccgcgcaccagaagatggcattc
aacccattcggccaaggctcaagacagtgtctgggtatccatctgggcaagctggagatg
cgccttgccgtcgctcacttcttccgggagctgcggggagccaagctggccaagtcggca
acacccgagagcatggcggtggtggacagtttcgtggcgggtgtgccgagggagcggaaa
tgcgaggtgacgatgaaggcacgatcagatgcacatgtgattggggtgttggagccgagg
gagaaacgcccatcaagttccagtggcagctttacgcaagattga

DBGET integrated database retrieval system