KEGG   Fulvia fulva: CLAFUR5_14299
Entry
CLAFUR5_14299     CDS       T08195                                 
Name
(RefSeq) Norsolorinic acid ketoreductase nor1
  KO
K17644  norsolorinic acid ketoreductase [EC:1.1.1.349]
Organism
ffu  Fulvia fulva
Pathway
ffu00254  Aflatoxin biosynthesis
ffu01100  Metabolic pathways
ffu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ffu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    CLAFUR5_14299
Enzymes [BR:ffu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.349  norsolorinic acid ketoreductase
     CLAFUR5_14299
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Epimerase RmlD_sub_bind NAD_binding_10 Mito_carr DUF1776
Other DBs
NCBI-GeneID: 71994177
NCBI-ProteinID: XP_047769498
LinkDB
Position
13:complement(676308..677325)
AA seq 280 aa
MIQTRQISKCQASTTPSPLAIGHRPKESTNRTTYLVTGASRGIGEGLVASFLGRPDSTVI
ACVRNAATQSKALSELPHAEGSSLIVVKLDCAVETDPAAVVEELQSTHNIRHIDVVVANA
AIAGAYGPTSTLPLDAVKEHMQINCYSVLLLFQATRPLLEQAAPGKAKFVFIGAPISTIT
QMEECARAPLGAYGLTKLAANYLVRKFHFENKWLMSFVIDPGHVQTDMGDSGARLMGRKE
APTTLQQSVDGIYLLQIDEATKEESSGQFLLHEDGSRLPW
NT seq 843 nt   +upstreamnt  +downstreamnt
atgatccaaacaagacagatatcaaaatgccaagcttccacaacaccatcaccattggcc
ataggccataggccgaaagaaagcacaaacaggacgacttatcttgtgactggtgccagt
agaggcatcggcgaaggcctcgtagcctcatttctcggaagaccagactcgaccgtaatc
gcctgtgtccgcaatgccgcaacacaatcaaaagccttaagcgagcttccacacgccgaa
ggcagctccctcatcgtcgtcaagctcgactgcgcagtcgagacagatccagccgcggtg
gtcgaggaactgcagtcaacacacaacatccgacacatagacgtcgtcgtagcaaatgca
gcgatcgctggcgcgtatggaccgacctcgaccttacctttggacgctgtcaaggagcac
atgcagatcaactgctactcagtgctcctcctcttccaagcaacgagaccgcttctggag
caagcagcaccagggaaggcgaaattcgtcttcatcggtgcgcccattagcaccattacg
cagatggaggagtgtgcaagagcgccgctcggggcgtatggtctgacaaaattggcggcg
aactatcttgttcgcaagttccattttgagaacaagtggttgatgtcgtttgtgattgat
cctggacatgtccagaccgatatgggagattccggtgccaggttgatggggcgtaaggaa
gcgccgacgacgctgcagcagagtgttgatggaatttaccttttgcagattgatgaagct
accaaggaagagtcgtcgggccagttcttgctgcatgaagatggatccagactgccatgg
tag

DBGET integrated database retrieval system