KEGG   Fulvia fulva: CLAFUR5_14375
Entry
CLAFUR5_14375     CDS       T08195                                 
Name
(RefSeq) Versicolorin reductase 1
  KO
K24856  NADPH-dependent reductase
Organism
ffu  Fulvia fulva
Pathway
ffu00254  Aflatoxin biosynthesis
ffu01100  Metabolic pathways
ffu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ffu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    CLAFUR5_14375
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase THF_DHG_CYH_C
Other DBs
NCBI-GeneID: 71994253
NCBI-ProteinID: XP_047769347
LinkDB
Position
13:complement(957012..957932)
AA seq 263 aa
MSADNFRLDGKVALVTGSGRGIGAAIAVELGKRGANVVVNYSRAVDEANKVVETVIANGT
KAIAIKADVREIDQVAKMMDQAVEHFGQLDIVSSNAGLVSFGHLKDVTGDEFDRVFRVNT
RGQFFVAREAYRHLSVGGRIILTSSNTASIKGVPKHAIYSGSKGAIDTFVRCMAIDAGDK
KITVNAVAPGAIKTDMYAAVAREYIPGGDKFTDEQVDECAAWLSPLERVGLPADIGRVVC
FLASDAAEWVSGKIIGIDGGAFR
NT seq 792 nt   +upstreamnt  +downstreamnt
atgtctgccgacaacttccgcctcgacggcaaggtcgcccttgtaactggatctggccgc
ggtattggtgccgccatcgcagtcgagctgggcaaacgtggtgcaaacgtcgttgtcaac
tactcacgagctgtcgatgaggccaacaaggttgtcgagaccgtcatcgccaacggcacc
aaggcaatcgccatcaaggccgatgttcgtgagatcgatcaggttgcgaagatgatggat
caggctgttgagcactttggtcaactcgatatcgtctcttcgaatgctggtcttgtgtct
tttggacacttgaaggatgttactggtgatgagttcgaccgtgtcttccgggtcaacacc
cgtggtcaattcttcgtggctcgcgaggcataccgacacctcagcgtcggcggccgcatc
atcctcacatcctccaacaccgcctcaatcaagggcgtacccaagcacgcaatctactcc
ggctccaagggcgccatcgacacattcgtccgctgcatggcaatagatgcaggcgacaaa
aagatcaccgtcaacgcagttgcccccggcgctatcaagactgacatgtacgctgctgtt
gcgcgcgagtacattcccggcggcgacaagttcaccgatgagcaagtcgatgagtgcgcc
gcctggctttctccgctggaacgtgttggcctaccagcagacattggccgtgttgtttgc
ttccttgcgtcggatgctgccgaatgggtcagtgggaagattattggtattgacggtggt
gccttcagatag

DBGET integrated database retrieval system