Fulmarus glacialis (Northern fulmar): 104069375 Help Entry 104069375         CDS       T08370                                  Symbol PFN4 Name (RefSeq) profilin-4   KO K05759   profilin Organism fga  Fulmarus glacialis (Northern fulmar) Pathway fga04810   Regulation of actin cytoskeleton fga05132   Salmonella infection Brite KEGG Orthology (KO) [BR:fga00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     104069375 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104069375 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fga04131]     104069375 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:fga04812]     104069375 (PFN4)    04147 Exosome [BR:fga04147]     104069375 (PFN4) Membrane trafficking [BR:fga04131]  Others   Actin-binding proteins    Others     104069375 (PFN4) Cytoskeleton proteins [BR:fga04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      104069375 (PFN4) Exosome [BR:fga04147]  Exosomal proteins   Proteins found in most exosomes    104069375 (PFN4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  104069375 NCBI-ProteinID:  XP_009584650 LinkDB All DBs Position Unknown AA seq 120 aa AA seqDB search MNQLQALLNDSLIRTKHVENAAIIDIKERQVCASTFGFNVPPENALNLIYTFYKNLLQVR RGGLYFKEKYYKCVRADEHSIYLQNPDGGLIVVKTKTFILVATYGVGMYPSVCVEAVEKL NT seq 361 nt NT seq  +upstreamnt  +downstreamnt atgaaccaactgcaggctttgctgaatgacagtcttatcagaacaaagcatgtggaaaat gcagctatcattgacataaaggaaagacaagtctgtgcatcaacctttggctttaatgtg ccaccagagaatgctttaaaccttatctacactttctacaagaacttattgcaagttaga aggggaggactctacttcaaggagaagtactataaatgtgtccgtgcggatgagcattcc atctatcttcaaaatccagatggaggcctgatagttgtaaagacaaagactttcatcctg gttgctacttacggagtgggcatgtatcccagtgtgtgcgtggaagctgtggagaaacta g

DBGET integrated database retrieval system