Fulmarus glacialis (Northern fulmar): 104069492 Help Entry 104069492         CDS       T08370                                  Symbol FGF20 Name (RefSeq) fibroblast growth factor 20   KO K04358   fibroblast growth factor Organism fga  Fulmarus glacialis (Northern fulmar) Pathway fga04010   MAPK signaling pathway fga04020   Calcium signaling pathway fga04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:fga00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104069492 (FGF20)    04020 Calcium signaling pathway     104069492 (FGF20)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     104069492 (FGF20)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:fga04052]     104069492 (FGF20)    00536 Glycosaminoglycan binding proteins [BR:fga00536]     104069492 (FGF20) Cytokines and neuropeptides [BR:fga04052]  Cytokines   Growth factors (RTK binding)    104069492 (FGF20) Glycosaminoglycan binding proteins [BR:fga00536]  Heparan sulfate / Heparin   Growth factors/receptors    104069492 (FGF20) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  104069492 NCBI-ProteinID:  XP_009575593 LinkDB All DBs Position Unknown AA seq 115 aa AA seqDB search ILEFISVAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTSECIFREQFEENWYNTYSSNVY KHGDSGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDVLGYS NT seq 350 nt NT seq  +upstreamnt  +downstreamnt gtatccttgaattcatcagtgtggcagtgggactggtcagtattagaggcgtggacagcg gcctttaccttggaatgaatgagaagggagaactctatggctctgagaaactaacttctg aatgcatcttcagggaacagtttgaggaaaactggtacaacacttactcatccaatgtgt acaaacatggagattcggggcggcgatactttgtagcacttaacaaagatggtactccca gagatggggcaaggtccaaaagacaccagaaattcacacatttcttgccccggcccgtgg atcccgaaagagttccagaactgtacaaagatgtgttaggatacagctga

DBGET integrated database retrieval system