Fulmarus glacialis (Northern fulmar): 104070418
Help
Entry
104070418 CDS
T08370
Symbol
MRPL18
Name
(RefSeq) 39S ribosomal protein L18, mitochondrial
KO
K02881
large subunit ribosomal protein L18
Organism
fga
Fulmarus glacialis (Northern fulmar)
Pathway
fga03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
fga00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
104070418 (MRPL18)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
fga03011
]
104070418 (MRPL18)
Ribosome [BR:
fga03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
104070418 (MRPL18)
Bacteria
104070418 (MRPL18)
Archaea
104070418 (MRPL18)
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
Ribosomal_L18p
DMA
Motif
Other DBs
NCBI-GeneID:
104070418
NCBI-ProteinID:
XP_009583357
LinkDB
All DBs
Position
Unknown
AA seq
101 aa
AA seq
DB search
LRLERTQRYVEAFVERCNGDVVVSASTREWAIKRHLYSPKGVTACKNLGRVMAQRCLEAG
INFVNFKAVIPWERRCDSIQEFEKAMEEGGVILREPRRIYQ
NT seq
307 nt
NT seq
+upstream
nt +downstream
nt
attacggcttgagcggacacagcgttatgtcgaagccttcgttgagcgctgtaatgggga
tgttgtggtgtctgcctctacccgagagtgggccataaagagacacctttacagtcctaa
gggagtaacagcgtgcaaaaaccttggccgtgtaatggcacagcgctgtttggaagcagg
aatcaactttgtgaactttaaagctgttatcccctgggaacgtcgttgtgactcgattca
ggaattcgaaaaagctatggaggaggggggtgtcattctgcgcgagccacgaagaatcta
tcagtag
DBGET
integrated database retrieval system