Fulmarus glacialis (Northern fulmar): 104071040 Help Entry 104071040         CDS       T08370                                  Symbol DYNLT3 Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism fga  Fulmarus glacialis (Northern fulmar) Pathway fga04814   Motor proteins fga05132   Salmonella infection Brite KEGG Orthology (KO) [BR:fga00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     104071040 (DYNLT3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104071040 (DYNLT3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:fga03037]     104071040 (DYNLT3)    04812 Cytoskeleton proteins [BR:fga04812]     104071040 (DYNLT3) Cilium and associated proteins [BR:fga03037]  Motile cilia and associated proteins   Dynein arm    104071040 (DYNLT3) Cytoskeleton proteins [BR:fga04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      104071040 (DYNLT3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  104071040 NCBI-ProteinID:  XP_009571987 LinkDB All DBs Position Unknown AA seq 106 aa AA seqDB search MIFNADEAHNIVKECIESVLGKADYNHNKVNQWTAAIVEQSLTHLVKLGKTYKYIVTCAV MQRSGAGLHTASSCFWDTTTDGTCTVRWENRTMNCIVNVFAVAIIL NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgatcttcaatgctgatgaggcccacaacatagttaaggagtgcatagaaagtgtttta ggcaaggcagattataatcacaacaaagtcaaccagtggactgctgctatagtagaacag tcgctgacacatctggtaaaactcggaaaaacatataagtacatcgtaacctgtgcggtg atgcagaggagtggagctggtcttcacacagcaagctcgtgcttctgggataccacaact gatggaacctgcacagtgaggtgggaaaaccgaacaatgaactgcattgtcaatgtgttt gctgttgctattatcctgtag

DBGET integrated database retrieval system