Fulmarus glacialis (Northern fulmar): 104071347 Help Entry 104071347         CDS       T08370                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism fga  Fulmarus glacialis (Northern fulmar) Pathway fga04010   MAPK signaling pathway fga04012   ErbB signaling pathway fga04068   FoxO signaling pathway fga04137   Mitophagy - animal fga04140   Autophagy - animal fga04150   mTOR signaling pathway fga04210   Apoptosis fga04218   Cellular senescence fga04370   VEGF signaling pathway fga04371   Apelin signaling pathway fga04540   Gap junction fga04625   C-type lectin receptor signaling pathway fga04810   Regulation of actin cytoskeleton fga04910   Insulin signaling pathway fga04912   GnRH signaling pathway fga04916   Melanogenesis Brite KEGG Orthology (KO) [BR:fga00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104071347 (NRAS)    04012 ErbB signaling pathway     104071347 (NRAS)    04370 VEGF signaling pathway     104071347 (NRAS)    04371 Apelin signaling pathway     104071347 (NRAS)    04068 FoxO signaling pathway     104071347 (NRAS)    04150 mTOR signaling pathway     104071347 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104071347 (NRAS)    04137 Mitophagy - animal     104071347 (NRAS)   09143 Cell growth and death    04210 Apoptosis     104071347 (NRAS)    04218 Cellular senescence     104071347 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     104071347 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104071347 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104071347 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     104071347 (NRAS)    04912 GnRH signaling pathway     104071347 (NRAS)    04916 Melanogenesis     104071347 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fga04131]     104071347 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fga04147]     104071347 (NRAS)    04031 GTP-binding proteins [BR:fga04031]     104071347 (NRAS) Membrane trafficking [BR:fga04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     104071347 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     104071347 (NRAS) Exosome [BR:fga04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104071347 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    104071347 (NRAS)   Exosomal proteins of breast cancer cells    104071347 (NRAS)   Exosomal proteins of colorectal cancer cells    104071347 (NRAS) GTP-binding proteins [BR:fga04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     104071347 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf FeoB_N RsgA_GTPase MMR_HSR1 IL23 Motif Other DBs NCBI-GeneID:  104071347 NCBI-ProteinID:  XP_009578682 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search QDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLY REQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAQELAKSYGIPFIETSAKTRQGVEDAF YTLVREIRQYRMKKLNSNEDGNQGCMGLSCIVM NT seq 462 nt NT seq  +upstreamnt  +downstreamnt caggattcgtatagaaagcaggttgttattgatggagagacgtgcttgttagacattctg gacactgcgggacaggaagagtatagtgctatgcgtgaccagtacatgagaactggggaa ggattcctctgtgtttttgccattaacaacagtaaatcgtttgctgatattaacctttac agagaacagatcaagagagtgaaagattcagatgatgtgccaatggtgctagttgggaat aagtgtgatttgcccacaagaacagtagacacaaaacaggctcaagaattagcaaaaagc tatggaatccccttcatagagacatctgcaaaaacaagacagggtgtggaagatgctttt tacacactggtgagagagatccggcagtaccggatgaaaaaacttaacagcaatgaagat gggaatcaaggctgtatgggattgtcttgcattgtgatgtga

DBGET integrated database retrieval system