Fulmarus glacialis (Northern fulmar): 104072347 Help Entry 104072347         CDS       T08370                                  Symbol ARF6 Name (RefSeq) ADP-ribosylation factor 6   KO K07941   ADP-ribosylation factor 6 Organism fga  Fulmarus glacialis (Northern fulmar) Pathway fga04144   Endocytosis fga04517   IgSF CAM signaling fga05132   Salmonella infection Brite KEGG Orthology (KO) [BR:fga00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     104072347 (ARF6)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     104072347 (ARF6)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104072347 (ARF6)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fga04131]     104072347 (ARF6)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fga04147]     104072347 (ARF6)    04031 GTP-binding proteins [BR:fga04031]     104072347 (ARF6) Membrane trafficking [BR:fga04131]  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     104072347 (ARF6)   Arf GTPases and associated proteins    Arf GTPases     104072347 (ARF6) Exosome [BR:fga04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104072347 (ARF6)   Exosomal proteins of colorectal cancer cells    104072347 (ARF6) GTP-binding proteins [BR:fga04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     104072347 (ARF6) SSDB OrthologParalogGFIT Motif Pfam:  Arf Roc Ras SRPRB G-alpha Gtr1_RagA MMR_HSR1 GTP_EFTU SpoOE-like CRISPR_Cas2 Motif Other DBs NCBI-GeneID:  104072347 NCBI-ProteinID:  XP_009575542 LinkDB All DBs Position Unknown AA seq 158 aa AA seqDB search MLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHY YTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQE KLGLTRIRDRNWYVQPSCATTGDGLYEGLTWLTSNYKS NT seq 477 nt NT seq  +upstreamnt  +downstreamnt atgctgggtctggacgcggctggtaaaaccaccatcctgtacaaactgaagctgggccag tccgtcaccaccatccccaccgtgggcttcaacgtggagacggttacttacaaaaacgtc aagttcaacgtgtgggatgtcgggggccaggacaagatccgtcccctctggaggcactac tacacgggcacgcaagggttgatctttgtggtggactgcgccgatcgcgaccgcatcgac gaggcccgccaggagctccaccgcattatcaatgacagggagatgcgggacgccatcatc ctcatcttcgccaacaagcaggacctgcctgatgccatgaaaccccatgaaatccaggag aaactgggcctgacccgaatcagggataggaattggtacgtgcagccctcctgtgctact acaggggatggactctatgaagggctgacatggttaacatccaattataaatcctaa

DBGET integrated database retrieval system