Fulmarus glacialis (Northern fulmar): 104073353 Help Entry 104073353         CDS       T08370                                  Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism fga  Fulmarus glacialis (Northern fulmar) Pathway fga04010   MAPK signaling pathway fga04012   ErbB signaling pathway fga04068   FoxO signaling pathway fga04137   Mitophagy - animal fga04140   Autophagy - animal fga04144   Endocytosis fga04150   mTOR signaling pathway fga04210   Apoptosis fga04218   Cellular senescence fga04370   VEGF signaling pathway fga04371   Apelin signaling pathway fga04510   Focal adhesion fga04519   Cadherin signaling fga04540   Gap junction fga04625   C-type lectin receptor signaling pathway fga04810   Regulation of actin cytoskeleton fga04910   Insulin signaling pathway fga04912   GnRH signaling pathway fga04916   Melanogenesis fga05132   Salmonella infection Brite KEGG Orthology (KO) [BR:fga00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104073353    04012 ErbB signaling pathway     104073353    04370 VEGF signaling pathway     104073353    04371 Apelin signaling pathway     104073353    04068 FoxO signaling pathway     104073353    04150 mTOR signaling pathway     104073353   09133 Signaling molecules and interaction    04519 Cadherin signaling     104073353  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     104073353    04140 Autophagy - animal     104073353    04137 Mitophagy - animal     104073353   09143 Cell growth and death    04210 Apoptosis     104073353    04218 Cellular senescence     104073353   09144 Cellular community - eukaryotes    04510 Focal adhesion     104073353    04540 Gap junction     104073353   09142 Cell motility    04810 Regulation of actin cytoskeleton     104073353  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104073353   09152 Endocrine system    04910 Insulin signaling pathway     104073353    04912 GnRH signaling pathway     104073353    04916 Melanogenesis     104073353  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104073353  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fga04131]     104073353   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fga04147]     104073353    04031 GTP-binding proteins [BR:fga04031]     104073353 Membrane trafficking [BR:fga04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     104073353  Endocytosis   Macropinocytosis    Ras GTPases     104073353 Exosome [BR:fga04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    104073353   Exosomal proteins of colorectal cancer cells    104073353 GTP-binding proteins [BR:fga04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     104073353 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc MMR_HSR1 Arf GTP_EFTU Septin RsgA_GTPase nSTAND3 Ldh_1_N AAA_16 NB-ARC Motif Other DBs NCBI-GeneID:  104073353 NCBI-ProteinID:  XP_009571372 LinkDB All DBs Position Unknown AA seq 133 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYRSVSREGGPGEETEQTANVSDSDK THPKGLLVAFGDS NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atgaccgaatataagctggtggtggtgggagccggtggtgtcgggaagagtgctttgacc atacagctcattcagaaccatttcgttgatgagtatgaccccacgatagaggattcctac agaaagcaagtcgtcatcgatggagagacctgcttgttagacatcttggataccgcaggg caagaggagtacagtgccatgagagaccagtacatgagaacgggggaaggattcctctgc gtctttgccatcaacaacaccaagtccttcgaagatattcaccagtacaggtcggtatcc cgggaaggtggccccggggaagagacggagcagacggctaatgtcagtgactccgataaa acccatccgaagggattgcttgtggcctttggggactcg

DBGET integrated database retrieval system