Fulmarus glacialis (Northern fulmar): 104073856 Help Entry 104073856         CDS       T08370                                  Name (RefSeq) claudin-1-like   KO K06087   claudin Organism fga  Fulmarus glacialis (Northern fulmar) Pathway fga03272   Virion - Hepatitis viruses fga04382   Cornified envelope formation fga04514   Cell adhesion molecule (CAM) interaction fga04530   Tight junction Brite KEGG Orthology (KO) [BR:fga00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     104073856  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     104073856  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     104073856  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     104073856  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:fga03037]     104073856    04147 Exosome [BR:fga04147]     104073856 Cilium and associated proteins [BR:fga03037]  Other cilia and associated proteins   Stereociliary proteins    104073856 Exosome [BR:fga04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    104073856   Exosomal proteins of colorectal cancer cells    104073856 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 DUF981 Voltage_CLC Cytochrom_B_C OppC_N CD20 DUF1218 DUF7937 DUF6232 DUF4131 FtsX DUF4134 Motif Other DBs NCBI-GeneID:  104073856 NCBI-ProteinID:  XP_009572082 LinkDB All DBs Position Unknown AA seq 154 aa AA seqDB search QSTRPLSPTELTSFALDVHLQATRALMVAAILLGLVALFVAVTGMKCMKCMEDDQVKKMR MAVFGGVIFIIAGLAALVATSWYGNRVARAFYDPFTPVNTRFEFGSALFIGWAAASLAML GGAFLCCSCPRRETSYPPTRGYPKNAPSTGKDYV NT seq 466 nt NT seq  +upstreamnt  +downstreamnt gcagagtacaaggccactgtcgcctaccgaactcacctcttttgcactggacgtgcatct gcaggccactcgggctttgatggtggctgcgatactcctgggccttgtcgctttatttgt tgctgtgactggcatgaaatgcatgaagtgcatggaagatgaccaggtgaagaagatgcg gatggctgtcttcggtggggtgatcttcatcattgcaggtttggcagcactggtggccac gtcatggtatggcaacagagtggctcgggccttttatgaccctttcacccctgtcaacac caggtttgagtttggatcagctctcttcattggctgggcagctgcttctctggccatgct ggggggagccttcctctgctgctcctgtccacggagagaaacttcatacccacccacccg aggctatccaaaaaatgccccctccacagggaaggattatgtataa

DBGET integrated database retrieval system