Fulmarus glacialis (Northern fulmar): 104075645 Help Entry 104075645         CDS       T08370                                  Symbol RFC5 Name (RefSeq) replication factor C subunit 5   KO K10756   replication factor C subunit 3/5 Organism fga  Fulmarus glacialis (Northern fulmar) Pathway fga03030   DNA replication fga03410   Base excision repair fga03420   Nucleotide excision repair fga03430   Mismatch repair Brite KEGG Orthology (KO) [BR:fga00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     104075645 (RFC5)    03410 Base excision repair     104075645 (RFC5)    03420 Nucleotide excision repair     104075645 (RFC5)    03430 Mismatch repair     104075645 (RFC5)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:fga03032]     104075645 (RFC5)    03036 Chromosome and associated proteins [BR:fga03036]     104075645 (RFC5)    03400 DNA repair and recombination proteins [BR:fga03400]     104075645 (RFC5) DNA replication proteins [BR:fga03032]  Eukaryotic type   DNA Replication Elongation Factors    RFC (replication factor C)     104075645 (RFC5)   DNA Replication Termination Factors    ELG1-RFC complex     104075645 (RFC5) Chromosome and associated proteins [BR:fga03036]  Eukaryotic type   Sister chromatid cohesion proteins    CTF18-RFC complex     104075645 (RFC5) DNA repair and recombination proteins [BR:fga03400]  Eukaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     RFC (replication factor C)      104075645 (RFC5)   Check point factors    HRAD17(Rad24)-RFC complex     104075645 (RFC5) SSDB OrthologParalogGFIT Motif Pfam:  Rep_fac_C DNA_pol3_delta2 RCF1-5-like_lid AAA AAA_assoc_2 AAA_lid_RFC1 DNAX_ATPase_lid Hydantoinase_B DEAD Motif Other DBs NCBI-GeneID:  104075645 NCBI-ProteinID:  XP_009574511 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search KGFKLVILDEADAMTQDAQNALVRVIEKFTENTRFCLICNYLSKIIPALQSRCTRFRFGP LTPELMVPRLRHVIQEEGVDVTEDGMKALVTLSSGDMRRALNILQSTTMAFGKVTEENVY TCTGHPLKSDIANILDWMLNQDFSTAYRKIMELKTLKGLALQDILTEIHLFVHRVDFPPS VRIQLLIKMADIE NT seq 583 nt NT seq  +upstreamnt  +downstreamnt gaaaggcttcaagctcgtcatcttggatgaagccgacgccatgacccaggatgctcagaa tgccttggtgagggtcatcgagaagttcacagaaaacacccgcttttgcctcatctgcaa ctacctctccaagatcatccctgccttgcagtcccgctgcacgcgcttccgcttcggccc cctcaccccggagctgatggtgccccggctgcggcacgtcatacaggaggagggggtgga tgtgactgaggatgggatgaaggctctggtgaccctctcgagcggtgacatgcgcagagc cctcaatatcttgcagagcaccaccatggctttcgggaaggtgactgaggagaacgtcta cacctgcacgggacaccccctcaagtctgacattgccaacatcctcgactggatgctgaa tcaggacttttccaccgcctatcgcaaaatcatggagctgaagacgctgaagggcttggc cctgcaggacatcctcaccgagatccacctctttgtgcacagagtcgatttcccaccctc ggtccgcattcagctgctgatcaaaatggcagacatcgagtaa

DBGET integrated database retrieval system