Fulmarus glacialis (Northern fulmar): 104076933 Help Entry 104076933         CDS       T08370                                  Symbol CSTA Name (RefSeq) cystatin-A   KO K13907   cystatin-A/B Organism fga  Fulmarus glacialis (Northern fulmar) Brite KEGG Orthology (KO) [BR:fga00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:fga01002]     104076933 (CSTA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fga04147]     104076933 (CSTA) Peptidases and inhibitors [BR:fga01002]  Peptidase inhibitors   Family I25: cystatin family    104076933 (CSTA) Exosome [BR:fga04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    104076933 (CSTA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cystatin Motif Other DBs NCBI-GeneID:  104076933 NCBI-ProteinID:  XP_009576261 LinkDB All DBs Position Unknown AA seq 56 aa AA seqDB search MMPGGLSEAKPATPEVQHIVNEVKPQFEIRENRTYGIFKAIVYKTQVVAGINYFIK NT seq 168 nt NT seq  +upstreamnt  +downstreamnt atgatgcctgggggcttatccgaggccaagcctgctactccagaagtccaacacattgtt aatgaggtgaagccacaatttgaaatcagggagaacaggacatacggcatctttaaagcc atagtatataagactcaggtggttgctgggataaactactttattaag

DBGET integrated database retrieval system