Fulmarus glacialis (Northern fulmar): 104077660 Help Entry 104077660         CDS       T08370                                  Name (RefSeq) calmodulin   KO K02183   calmodulin Organism fga  Fulmarus glacialis (Northern fulmar) Pathway fga04020   Calcium signaling pathway fga04070   Phosphatidylinositol signaling system fga04114   Oocyte meiosis fga04218   Cellular senescence fga04261   Adrenergic signaling in cardiomyocytes fga04270   Vascular smooth muscle contraction fga04371   Apelin signaling pathway fga04625   C-type lectin receptor signaling pathway fga04744   Phototransduction fga04910   Insulin signaling pathway fga04912   GnRH signaling pathway fga04916   Melanogenesis Brite KEGG Orthology (KO) [BR:fga00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     104077660    04020 Calcium signaling pathway     104077660    04070 Phosphatidylinositol signaling system     104077660  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     104077660    04218 Cellular senescence     104077660  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104077660   09152 Endocrine system    04910 Insulin signaling pathway     104077660    04912 GnRH signaling pathway     104077660    04916 Melanogenesis     104077660   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     104077660    04270 Vascular smooth muscle contraction     104077660   09157 Sensory system    04744 Phototransduction     104077660  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:fga01009]     104077660   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fga04131]     104077660    03036 Chromosome and associated proteins [BR:fga03036]     104077660   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fga04147]     104077660 Protein phosphatases and associated proteins [BR:fga01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      104077660 Membrane trafficking [BR:fga04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     104077660 Chromosome and associated proteins [BR:fga03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      104077660 Exosome [BR:fga04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    104077660 SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_6 EF-hand_5 CFAP251_C EFhand_Ca_insen EF_EFCAB10_C EF-hand_9 AIF-1 EF-hand_FSTL1 Dockerin_1 EF-hand_EFHB_C EF-hand_11 BamM_C EH FCaBP_EF-hand SPARC_Ca_bdg DnaT_2 DUF5580_M Motif Other DBs NCBI-GeneID:  104077660 NCBI-ProteinID:  XP_009577260 LinkDB All DBs Position Unknown AA seq 100 aa AA seqDB search SGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLT DEEVDEMIREADIDGDGQVNYEGKCHCHPAVTSSVSSVTH NT seq 302 nt NT seq  +upstreamnt  +downstreamnt tcaggcaacggcaccatcgacttccccgagttcctcaccatgatggcgaggaagatgaag gacacggacagcgaggaggagatccgcgaggctttccgtgtcttcgacaaggacgggaac gggtacatcagcgcggcggagctgcggcacgtgatgaccaacctgggggagaagctgacg gacgaggaggtggacgagatgatccgagaggccgacatcgacggtgacggacaggtcaac tatgagggtaagtgccactgtcaccccgctgtcacctccagtgtctcctctgtcacccac ag

DBGET integrated database retrieval system