Fulmarus glacialis (Northern fulmar): 104077725 Help Entry 104077725         CDS       T08370                                  Name (RefSeq) histone H2B 8-like   KO K11252   histone H2B Organism fga  Fulmarus glacialis (Northern fulmar) Brite KEGG Orthology (KO) [BR:fga00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fga03036]     104077725   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fga04147]     104077725 Chromosome and associated proteins [BR:fga03036]  Eukaryotic type   Nucleosome assembly factors    Histones     104077725 Exosome [BR:fga04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104077725 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone RNA_pol_Rpc34 Motif Other DBs NCBI-GeneID:  104077725 NCBI-ProteinID:  XP_009577347 LinkDB All DBs Position Unknown AA seq 96 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKTQKKGDKKRRKTRKESYSIYVYKVLKQVHPDTGISRSTI TSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgccggaaccagctaaatccgctcctgctccaaagaagggctccaagaaagccgtcacc aagacgcagaagaagggcgacaagaaacgcagaaagactaggaaggagagctactcgatc tacgtgtacaaggtgctgaagcaggtgcaccccgacacgggcatctcgcgctccaccatc acctcgcgggagatccagacggccgtgcggctcctgctgcccggcgagctggccaagcac gccgtctccgagggcaccaaggccgtcaccaagtacaccagctccaagtag

DBGET integrated database retrieval system