Fulmarus glacialis (Northern fulmar): 104077877 Help Entry 104077877         CDS       T08370                                  Symbol PRNP Name (RefSeq) major prion protein homolog   KO K05634   prion protein Organism fga  Fulmarus glacialis (Northern fulmar) Pathway fga04216   Ferroptosis Brite KEGG Orthology (KO) [BR:fga00001]  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     104077877 (PRNP)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fga04147]     104077877 (PRNP)    04090 CD molecules [BR:fga04090]     104077877 (PRNP)    00536 Glycosaminoglycan binding proteins [BR:fga00536]     104077877 (PRNP)    00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fga00537]     104077877 (PRNP) Exosome [BR:fga04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    104077877 (PRNP) CD molecules [BR:fga04090]  Proteins   104077877 (PRNP) Glycosaminoglycan binding proteins [BR:fga00536]  Heparan sulfate / Heparin   Others    104077877 (PRNP) Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fga00537]  Others   104077877 (PRNP) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Prion Motif Other DBs NCBI-GeneID:  104077877 NCBI-ProteinID:  XP_009577575 LinkDB All DBs Position Unknown AA seq 131 aa AA seqDB search YAMGRVMSGMHYRFDSPDEYRWWNENSARYPNQVYYRDYRSPVSQDVFVADCFNITVTEY NIGPAAKKNASEVGPAANQTETELETKVVTKVIREMCIQQYREYRLASGIRLHLANASLA ALLLLTLFAMH NT seq 396 nt NT seq  +upstreamnt  +downstreamnt tacgccatgggacgcgtcatgtcagggatgcactatcgcttcgacagccccgatgagtac cgatggtggaacgaaaattcggcgcgttaccccaaccaggtttactaccgggattaccgc agccccgtctcgcaggacgtcttcgtcgccgactgctttaacatcacggtgaccgaatac aacatcggacccgccgccaagaagaacgcgtcggaggttggtccggcggccaaccaaacg gagacggagctggagaccaaggtggtgacgaaggtgatccgggagatgtgcatccagcag taccgcgagtaccgcctggcctccggcatccggctgcacctcgccaacgcctccctcgcc gccctcctcctcctcaccctcttcgccatgcactga

DBGET integrated database retrieval system