Fulmarus glacialis (Northern fulmar): 104080538 Help Entry 104080538         CDS       T08370                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism fga  Fulmarus glacialis (Northern fulmar) Pathway fga04081   Hormone signaling fga04144   Endocytosis fga04150   mTOR signaling pathway fga04270   Vascular smooth muscle contraction fga04310   Wnt signaling pathway fga04350   TGF-beta signaling pathway fga04510   Focal adhesion fga04517   IgSF CAM signaling fga04519   Cadherin signaling fga04520   Adherens junction fga04530   Tight junction fga04621   NOD-like receptor signaling pathway fga04625   C-type lectin receptor signaling pathway fga04810   Regulation of actin cytoskeleton fga05100   Bacterial invasion of epithelial cells fga05132   Salmonella infection Brite KEGG Orthology (KO) [BR:fga00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     104080538 (RHOA)    04350 TGF-beta signaling pathway     104080538 (RHOA)    04150 mTOR signaling pathway     104080538 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     104080538 (RHOA)    04517 IgSF CAM signaling     104080538 (RHOA)    04519 Cadherin signaling     104080538 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     104080538 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     104080538 (RHOA)    04520 Adherens junction     104080538 (RHOA)    04530 Tight junction     104080538 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104080538 (RHOA)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     104080538 (RHOA)    04625 C-type lectin receptor signaling pathway     104080538 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     104080538 (RHOA)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104080538 (RHOA)    05100 Bacterial invasion of epithelial cells     104080538 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fga04131]     104080538 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fga04147]     104080538 (RHOA)    04031 GTP-binding proteins [BR:fga04031]     104080538 (RHOA) Membrane trafficking [BR:fga04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     104080538 (RHOA) Exosome [BR:fga04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104080538 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    104080538 (RHOA)   Exosomal proteins of colorectal cancer cells    104080538 (RHOA)   Exosomal proteins of bladder cancer cells    104080538 (RHOA) GTP-binding proteins [BR:fga04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     104080538 (RHOA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  104080538 NCBI-ProteinID:  XP_009581252 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagccattcgaaaaaagctggttatagtgggtgatggtgcctgtggaaagacctgt ctgctgattgtatttagcaaagaccagttccctgaagtgtatgttcccaccgtctttgaa aattatgtagcagatattgaagtggatggaaagcaggttgagttggctttgtgggataca gcaggacaagaagactatgatcgacttagaccgctttcttatccagatactgatgttata cttatgtgtttttcaattgatagtcctgatagtttagaaaacatcccagagaagtggacc ccggaggtgaagcatttctgccccaacgtgcctatcatcttggtaggaaacaagaaggac ctgaggaatgatgagcacacaagacgagagctggccaaaatgaagcaggagcctgtcaaa cccgaagaaggaagagatatggcaaaccgcattggtgcatttgggtatatggagtgttcg gcaaagaccaaagacggtgtgagggaggtttttgaaatggccactagagctgctttgcaa gcccggcgtggcaagaaaaagtccgggtgccttctcttataa

DBGET integrated database retrieval system