Fulmarus glacialis (Northern fulmar): 104081182 Help Entry 104081182         CDS       T08370                                  Symbol TMEM138 Name (RefSeq) transmembrane protein 138   KO K22867   transmembrane protein 138 Organism fga  Fulmarus glacialis (Northern fulmar) Brite KEGG Orthology (KO) [BR:fga00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:fga03037]     104081182 (TMEM138) Cilium and associated proteins [BR:fga03037]  Primary cilia and associated proteins   Other primary cilia associated proteins    104081182 (TMEM138) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  TMEM138 Motif Other DBs NCBI-GeneID:  104081182 NCBI-ProteinID:  XP_009582111 LinkDB All DBs Position Unknown AA seq 102 aa AA seqDB search MLQTSNYSLVLFLQFLLLFYDLFVNSFSELLRTAPAVQLVLFIIQDIAILFNVIIIFLMF FNTFVFQAGLVNLLFHKFKGTILLSAAYLVLSISFHVWVMVG NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgctccagaccagcaactacagcctggtgctgttcctgcagttccttttgcttttctac gacctctttgtcaactctttctcggagctgctccgcacagctcctgccgtccagctcgtc ctcttcatcatccaggacatcgctattctcttcaacgtcatcatcatcttcctcatgttc ttcaacaccttcgtcttccaggccgggctggtcaatctcctcttccacaagttcaagggg accatcctactgtcggcggcctacctggtgctcagcatctccttccacgtctgggttatg gtaggctga

DBGET integrated database retrieval system