Fulmarus glacialis (Northern fulmar): 104082836 Help Entry 104082836         CDS       T08370                                  Symbol CLDN23 Name (RefSeq) claudin-23   KO K06087   claudin Organism fga  Fulmarus glacialis (Northern fulmar) Pathway fga03272   Virion - Hepatitis viruses fga04382   Cornified envelope formation fga04514   Cell adhesion molecules fga04530   Tight junction Brite KEGG Orthology (KO) [BR:fga00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     104082836 (CLDN23)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     104082836 (CLDN23)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     104082836 (CLDN23)  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     104082836 (CLDN23)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:fga03037]     104082836 (CLDN23)    04147 Exosome [BR:fga04147]     104082836 (CLDN23)    04515 Cell adhesion molecules [BR:fga04515]     104082836 (CLDN23) Cilium and associated proteins [BR:fga03037]  Other cilia and associated proteins   Stereociliary proteins    104082836 (CLDN23) Exosome [BR:fga04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    104082836 (CLDN23)   Exosomal proteins of colorectal cancer cells    104082836 (CLDN23) Cell adhesion molecules [BR:fga04515]  Immunoglobulin superfamily   L1 family    104082836 (CLDN23) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin UbiA Motif Other DBs NCBI-GeneID:  104082836 NCBI-ProteinID:  XP_009584389 LinkDB All DBs Position Unknown AA seq 169 aa AA seqDB search VPNQPIDLILEQGIWDMCREQQSNHDRLCGQADELGYFEQVPVRVARGLMPTSLVLTLLG LVVAALGVRCWQKEPLWALPAPAGSTLVVGYSLVLSYLGSCLEILGGLALALSFHHCCKE RRAPKLPPSPVLEAGPCSITGAYRNPWDVLEDERDGRHGRSTLPCDSDL NT seq 510 nt NT seq  +upstreamnt  +downstreamnt gtacccaaccagcccattgacctcatcttggagcaaggcatctgggacatgtgcagagag cagcagagcaaccatgaccgcctctgcgggcaggctgatgagctgggctacttcgagcag gtgcccgtgcgggtggcccgagggctgatgcccacctcgctggtgcttaccctcctgggc ttggtggtggctgccctgggggttcgctgctggcagaaggagccactgtgggcactgccc gcaccggctggcagcacgctggttgtaggctacagcttggtgctgagctacttgggaagc tgtctggagattttgggggggctggccctcgccctcagcttccaccactgctgcaaggag cgcagggcccccaaactgccccccagccctgtgctggaggctgggccatgctccatcact ggggcttaccgcaatccctgggacgtgctggaggacgagcgagacggacgacacgggagg agcaccctgccttgtgactccgacttgtag

DBGET integrated database retrieval system