Flavisolibacter ginsenosidimutans: FSB75_16895 Help Entry FSB75_16895       CDS       T06122                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism fgg  Flavisolibacter ginsenosidimutans Brite KEGG Orthology (KO) [BR:fgg00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:fgg03032]     FSB75_16895    03036 Chromosome and associated proteins [BR:fgg03036]     FSB75_16895    03400 DNA repair and recombination proteins [BR:fgg03400]     FSB75_16895 DNA replication proteins [BR:fgg03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     FSB75_16895 Chromosome and associated proteins [BR:fgg03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     FSB75_16895 DNA repair and recombination proteins [BR:fgg03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       FSB75_16895 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_1 HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  QEC57506 UniProt:  A0A5B8UM12 LinkDB All DBs Position complement(3966926..3967195) Genome browser AA seq 89 aa AA seqDB search MNKAELIAKIADDAGITKTQANTALDSFVEAVTKTLKGGGKVTLVGFGTFSVSKRAARNG RNPQTGEVIKIKARKVARFKAGKELSAKL NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgaacaaagctgaactgatcgcaaaaattgctgatgatgccggcatcaccaagacccag gcaaacaccgcccttgattcgtttgtagaagccgtaaccaaaaccctgaaaggtggtggt aaagtaacgctggttggcttcggaactttctccgtatccaagcgtgcagcccgcaacggc cgcaacccgcaaaccggtgaggttattaaaatcaaagcccgcaaagtggcccgtttcaaa gccggtaaagaactttctgctaagttgtaa

DBGET integrated database retrieval system