Fimbriimonas ginsengisoli: OP10G_0199 Help Entry OP10G_0199        CDS       T03038                                  Name (GenBank) hypothetical protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism fgi  Fimbriimonas ginsengisoli Pathway fgi02020   Two-component system fgi02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:fgi00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     OP10G_0199  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     OP10G_0199  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:fgi02035]     OP10G_0199 Bacterial motility proteins [BR:fgi02035]  Flagellar system   Flagellar assembly proteins    Others     OP10G_0199 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM DUF3819 ATPD_C_metazoa Motif Other DBs NCBI-ProteinID:  AIE83567 UniProt:  A0A068NJG2 LinkDB All DBs Position complement(192563..192832) Genome browser AA seq 89 aa AA seqDB search MRISDTEVQKIRSTTPANIVEEIVEIGETRVREEDHALVEKLTDEIAGMSDREAMIAELR AKIEAGTYNPSAEDIVDGMVRRAIADRIR NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgcggatttcagacaccgaagtacagaagattagaagcacgaccccggcgaatatcgtc gaggagatcgtggagatcggcgaaacgcgcgttcgcgaggaggaccatgcgctcgtggag aagcttacggacgagatagcggggatgtcggatagggaagcgatgatcgcggaactccga gccaagattgaggcaggcacctacaacccctcggccgaagatatcgttgatgggatggta cggcgagcaatcgccgaccggattcgttaa

DBGET integrated database retrieval system