Fusarium graminearum: FGSG_00886 Help Entry FGSG_00886        CDS       T01038                                  Name (RefSeq) hypothetical protein   KO K10418   dynein light chain LC8-type Organism fgr  Fusarium graminearum Pathway fgr04517   IgSF CAM signaling fgr04814   Motor proteins Brite KEGG Orthology (KO) [BR:fgr00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     FGSG_00886  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     FGSG_00886  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:fgr03037]     FGSG_00886    04812 Cytoskeleton proteins [BR:fgr04812]     FGSG_00886 Cilium and associated proteins [BR:fgr03037]  Motile cilia and associated proteins   Dynein arm    FGSG_00886 Cytoskeleton proteins [BR:fgr04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      FGSG_00886 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light SGTA_dimer Motif Other DBs NCBI-GeneID:  23548353 NCBI-ProteinID:  XP_011316618 UniProt:  I1RBG4 LinkDB All DBs Position 1:2904425..2905725 Genome browser AA seq 103 aa AA seqDB search MSDAHAPKAESPVPREKLEAQIKSADMTEDMQQESIEVAQEAMAKFTIEKDIAQHIKRTF DERKGPTWHCIVGRNFGSFVTHETKHFIYFYLGHCAILLFKTQ NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtccgacgctcacgctcccaaggcagagtctcccgttccccgggagaagctcgaggct cagatcaagtccgccgacatgacggaggacatgcaacaagagtccattgaagttgctcag gaggctatggccaagttcactattgaaaaggacatcgcacagcacatcaagcgaaccttc gacgagcgaaagggacctacctggcactgtattgttggtcgcaactttggcagcttcgtc actcacgagactaagcactttatctacttctaccttggccactgcgcaattttactattc aaaacgcaatag

DBGET integrated database retrieval system