Fusarium graminearum: FGSG_01528 Help Entry FGSG_01528        CDS       T01038                                  Name (RefSeq) hypothetical protein   KO K09481   protein transport protein SEC61 subunit beta Organism fgr  Fusarium graminearum Pathway fgr03060   Protein export fgr04141   Protein processing in endoplasmic reticulum fgr04145   Phagosome Brite KEGG Orthology (KO) [BR:fgr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     FGSG_01528    04141 Protein processing in endoplasmic reticulum     FGSG_01528  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     FGSG_01528  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fgr04131]     FGSG_01528   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:fgr02044]     FGSG_01528 Membrane trafficking [BR:fgr04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     FGSG_01528 Secretion system [BR:fgr02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    FGSG_01528 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sec61_beta Motif Other DBs NCBI-GeneID:  23548962 NCBI-ProteinID:  XP_011317338 UniProt:  I1RD39 LinkDB All DBs Position 1:5043914..5045308 Genome browser AA seq 113 aa AA seqDB search MSSPRPSSPVNGGAAASGANIGRPSSPAIPGGPRTAIRRRAAADQKEKIANARPSSTRAA GAGGSSSTMLRLYTDESPGLKVDPVVVLVLSLVFIFSVVALHIIAKITRKFSS NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgtcttctcctcgtccttcttcccccgtcaacggcggcgctgctgccagcggtgccaac atcggccgaccctcatcacctgctatccctggtggtccccgtactgccatccgacgacgc gctgccgccgaccagaaggagaagattgccaatgcccgaccaagcagcactcgcgccgct ggcgccggtggttccagcagcaccatgctgcgactttacaccgatgagtcgcccggtctc aaggtcgaccctgttgttgtccttgttctctctcttgtctttatcttcagcgttgttgct cttcacattatcgccaagattacccgaaagttctccagctaa

DBGET integrated database retrieval system