Fusarium graminearum: FGSG_04037 Help Entry FGSG_04037        CDS       T01038                                  Name (RefSeq) hypothetical protein   KO K03009   DNA-directed RNA polymerases I, II, and III subunit RPABC4 Organism fgr  Fusarium graminearum Pathway fgr03020   RNA polymerase fgr03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:fgr00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     FGSG_04037   09124 Replication and repair    03420 Nucleotide excision repair     FGSG_04037  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:fgr03021]     FGSG_04037    03400 DNA repair and recombination proteins [BR:fgr03400]     FGSG_04037 Transcription machinery [BR:fgr03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      FGSG_04037   RNA polymerase III system    RNA polymerase III      FGSG_04037   RNA polymerase I system    RNA polymerase I      FGSG_04037 DNA repair and recombination proteins [BR:fgr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       FGSG_04037 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Zn_ribbon_RPAB4 Zn_Ribbon_YjdM Zn_ribbon_19 Zn_ribbon_8 DUF7130 Zn_ribbon_IS1595 DnaJ_CXXCXGXG DUF7129 Motif Other DBs NCBI-GeneID:  23551307 NCBI-ProteinID:  XP_011321616 UniProt:  I1RJL2 LinkDB All DBs Position 2:complement(5327363..5327977) Genome browser AA seq 72 aa AA seqDB search MSREGYQIPTASTGQRGGTRDDQQVRHVMSYLCGDCGGSVTLGKDALVACPHCAGRILYK ERTKRMVQFEAR NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgtctcgcgaagggtaccaaattcctaccgcctctaccggccagcgtggcggtacccgc gacgaccaacaggtccgccatgtcatgtcttacctctgcggcgattgcggcggcagcgtc accctcggcaaggacgctcttgtcgcgtgccctcactgcgccggtcgcattctctacaag gaacgaactaagcgtatggtgcagttcgaggcccgatag

DBGET integrated database retrieval system