Fusarium graminearum: FGSG_04273 Help Entry FGSG_04273        CDS       T01038                                  Name (RefSeq) hypothetical protein   KO K03016   DNA-directed RNA polymerases I, II, and III subunit RPABC3 Organism fgr  Fusarium graminearum Pathway fgr03020   RNA polymerase fgr03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:fgr00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     FGSG_04273   09124 Replication and repair    03420 Nucleotide excision repair     FGSG_04273  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:fgr03021]     FGSG_04273    03400 DNA repair and recombination proteins [BR:fgr03400]     FGSG_04273 Transcription machinery [BR:fgr03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      FGSG_04273   RNA polymerase III system    RNA polymerase III      FGSG_04273   RNA polymerase I system    RNA polymerase I      FGSG_04273 DNA repair and recombination proteins [BR:fgr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       FGSG_04273 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_Rpb8 RNA_pol_RpbG Motif Other DBs NCBI-GeneID:  23551531 NCBI-ProteinID:  XP_011321345 UniProt:  I1RK79 LinkDB All DBs Position 2:4590436..4591540 Genome browser AA seq 148 aa AA seqDB search MASGDATLFEESFTVMEYDQSKYDRVARIHCTSADSQTIMSLDINIELFPCVRGDSLHVV LTTTLALDGSKEEEKGWRDVGKGGDAPATIADLYDYVCHGKIYKFEETFDGNTINAYVSF GGLLMSLQGPVKKLTPLRVDNVYLLVKK NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atggccagcggagatgccaccctctttgaggagtcctttaccgtaatggagtacgatcag tccaagtatgaccgtgtcgcacgcattcattgcacatcggccgactcgcagaccatcatg tcactcgatatcaacatcgaactattcccttgtgtccgtggtgactctctgcacgtcgtt ttgacaacaacgctggctctggatggaagcaaggaggaggagaagggctggcgggacgtt ggtaagggcggtgatgcgccagccacgattgccgacctctacgactatgtgtgccatggc aaaatctacaagttcgaagagacattcgatggaaacaccatcaatgcttacgtctctttc ggtggtctcctcatgtcgctccagggccctgtcaagaagttgactccgctccgcgtcgat aacgtctaccttcttgtcaagaaataa

DBGET integrated database retrieval system