KEGG   Fusarium graminearum: FGSG_06415
Entry
FGSG_06415        CDS       T01038                                 
Name
(RefSeq) hypothetical protein
  KO
K17795  mitochondrial import inner membrane translocase subunit TIM17
Organism
fgr  Fusarium graminearum
Brite
KEGG Orthology (KO) [BR:fgr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:fgr03029]
    FGSG_06415
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:fgr02000]
    FGSG_06415
Mitochondrial biogenesis [BR:fgr03029]
 Mitochondrial protein import machinery
  Inner mambrane
   TIM23 complex
    FGSG_06415
Transporters [BR:fgr02000]
 Other transporters
  Primary active transporters [TC:3]
   FGSG_06415
SSDB
Motif
Pfam: Tim17
Other DBs
NCBI-GeneID: 23553548
NCBI-ProteinID: XP_011325079
UniProt: I1RQR6
LinkDB
Position
3:5304262..5306374
AA seq 152 aa
MDHGRDPCPYVILNDFGGAFCMGAIGGTIWHGIKGFRNSPYGERRIGAITAIKMRAPVLG
GNFGVWGGLFSTFDCAVKGVRQKEDPYNAIIAGFFTGGSLAIRGGYKAARNGAIGCAVLL
AVIEGVGIGFSKMLAGSTKLEAPQPPPQEATL
NT seq 459 nt   +upstreamnt  +downstreamnt
atggatcacggacgagacccctgcccctatgtcattctcaatgactttggcggtgctttc
tgcatgggtgccatcggtggtactatctggcacggtatcaagggtttccgcaactctccc
tacggcgagcgacgcattggcgccatcacagccattaagatgcgcgctccagttctaggt
ggtaacttcggtgtttggggtggtcttttctcgacattcgactgcgccgttaagggcgtg
cgccagaaggaggacccttacaacgccatcattgccggcttcttcaccggcggttctctc
gccattcgaggtggttacaaggctgcacggaacggtgccatcggttgtgccgttcttctc
gccgtcatcgagggtgtcggtatcggtttctccaaaatgcttgccggcagcactaagcta
gaagctcctcagcctcctccccaggaagccactctgtga

DBGET integrated database retrieval system