Fusarium graminearum: FGSG_06415
Help
Entry
FGSG_06415 CDS
T01038
Name
(RefSeq) hypothetical protein
KO
K17795
mitochondrial import inner membrane translocase subunit TIM17
Organism
fgr
Fusarium graminearum
Brite
KEGG Orthology (KO) [BR:
fgr00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03029 Mitochondrial biogenesis [BR:
fgr03029
]
FGSG_06415
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
fgr02000
]
FGSG_06415
Mitochondrial biogenesis [BR:
fgr03029
]
Mitochondrial protein import machinery
Inner mambrane
TIM23 complex
FGSG_06415
Transporters [BR:
fgr02000
]
Other transporters
Primary active transporters [TC:
3
]
FGSG_06415
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Tim17
Motif
Other DBs
NCBI-GeneID:
23553548
NCBI-ProteinID:
XP_011325079
UniProt:
I1RQR6
LinkDB
All DBs
Position
3:5304262..5306374
Genome browser
AA seq
152 aa
AA seq
DB search
MDHGRDPCPYVILNDFGGAFCMGAIGGTIWHGIKGFRNSPYGERRIGAITAIKMRAPVLG
GNFGVWGGLFSTFDCAVKGVRQKEDPYNAIIAGFFTGGSLAIRGGYKAARNGAIGCAVLL
AVIEGVGIGFSKMLAGSTKLEAPQPPPQEATL
NT seq
459 nt
NT seq
+upstream
nt +downstream
nt
atggatcacggacgagacccctgcccctatgtcattctcaatgactttggcggtgctttc
tgcatgggtgccatcggtggtactatctggcacggtatcaagggtttccgcaactctccc
tacggcgagcgacgcattggcgccatcacagccattaagatgcgcgctccagttctaggt
ggtaacttcggtgtttggggtggtcttttctcgacattcgactgcgccgttaagggcgtg
cgccagaaggaggacccttacaacgccatcattgccggcttcttcaccggcggttctctc
gccattcgaggtggttacaaggctgcacggaacggtgccatcggttgtgccgttcttctc
gccgtcatcgagggtgtcggtatcggtttctccaaaatgcttgccggcagcactaagcta
gaagctcctcagcctcctccccaggaagccactctgtga
DBGET
integrated database retrieval system