Fusarium graminearum: FGSG_07339 Help Entry FGSG_07339        CDS       T01038                                  Name (RefSeq) hypothetical protein   KO K12161   ubiquitin related modifier 1 Organism fgr  Fusarium graminearum Pathway fgr04122   Sulfur relay system Brite KEGG Orthology (KO) [BR:fgr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04122 Sulfur relay system     FGSG_07339  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:fgr03016]     FGSG_07339    04121 Ubiquitin system [BR:fgr04121]     FGSG_07339 Transfer RNA biogenesis [BR:fgr03016]  Eukaryotic type   tRNA modification factors    Thiolation factors     FGSG_07339 Ubiquitin system [BR:fgr04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    FGSG_07339 SSDB OrthologParalogGFIT Motif Pfam:  Urm1 ThiS Motif Other DBs NCBI-GeneID:  23554422 NCBI-ProteinID:  XP_011327090 UniProt:  I1RT45 LinkDB All DBs Position 4:<3180920..>3181711 Genome browser AA seq 110 aa AA seqDB search MVESASSPMLSIDVEFSGGLEMLFSNKRQHALSIPAVGQDGKPADIAYLINYLCQNVMDD SRKDLFVLDSHLRPGILVLINDADWELEGEEAYEIQSGDNILFVSTLHGG NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atggtcgaatcagcatcttccccaatgctcagcatcgacgtggagttctctggcgggctg gagatgctcttttcgaataaacgacagcacgctctgtcgattcccgcggtaggccaagat gggaaacccgccgacatcgcgtacttgataaactacctatgtcagaacgtcatggacgat tctcgcaaggacctcttcgttctagacagccatcttcgaccgggcatcctagttctcatc aacgatgccgactgggagctcgaaggcgaggaggcctacgagatacagagcggtgacaac atcttgtttgtctcgactctgcatggaggttag

DBGET integrated database retrieval system