Fusarium graminearum: FGSG_11855 Help Entry FGSG_11855        CDS       T01038                                  Name (RefSeq) hypothetical protein   KO K03007   DNA-directed RNA polymerases I, II, and III subunit RPABC5 Organism fgr  Fusarium graminearum Pathway fgr03020   RNA polymerase fgr03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:fgr00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     FGSG_11855   09124 Replication and repair    03420 Nucleotide excision repair     FGSG_11855  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:fgr03021]     FGSG_11855    03400 DNA repair and recombination proteins [BR:fgr03400]     FGSG_11855 Transcription machinery [BR:fgr03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      FGSG_11855   RNA polymerase III system    RNA polymerase III      FGSG_11855   RNA polymerase I system    RNA polymerase I      FGSG_11855 DNA repair and recombination proteins [BR:fgr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       FGSG_11855 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_N Motif Other DBs NCBI-GeneID:  23558674 NCBI-ProteinID:  XP_011316625 UniProt:  I1S4T7 LinkDB All DBs Position 1:complement(2931949..2932154) Genome browser AA seq 49 aa AA seqDB search MDELGLKRYCCRRMIMTHVDLIEKLLKYTPDGRNEKKQQLRQHMSQEQE NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggacgagctcggtctcaagcgatactgctgccgccgtatgatcatgacccacgttgac cttatcgagaagcttctcaagtacactcctgacggacgaaacgagaagaagcagcaattg cgccagcacatgtctcaagaacaagaatga

DBGET integrated database retrieval system