Fusarium graminearum: FGSG_13910 Help Entry FGSG_13910        CDS       T01038                                  Name (RefSeq) hypothetical protein   KO K00730   dolichyl-diphosphooligosaccharide---protein glycosyltransferase subunit 4 Organism fgr  Fusarium graminearum Pathway fgr00510   N-Glycan biosynthesis fgr00513   Various types of N-glycan biosynthesis fgr01100   Metabolic pathways fgr04141   Protein processing in endoplasmic reticulum Module fgr_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:fgr00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     FGSG_13910    00513 Various types of N-glycan biosynthesis     FGSG_13910  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     FGSG_13910 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost4 Motif Other DBs NCBI-GeneID:  23560713 NCBI-ProteinID:  XP_011325565 UniProt:  I1SAM9 LinkDB All DBs Position 3:complement(6565186..6565781) Genome browser AA seq 48 aa AA seqDB search MITDGQLYQLAIFFGVAAMLLILVYHFLEVNAPKNTAASGKEGASKSL NT seq 147 nt NT seq  +upstreamnt  +downstreamnt atgattaccgacggccagctctatcaactagccatcttcttcggcgtcgcggcaatgctt ctcatcctcgtctaccacttcctcgaagtcaacgccccgaaaaacacagctgcaagtggg aaggagggagcttcaaagtcgctatga

DBGET integrated database retrieval system