Francisella halioticida: CDV26_07170 Help Entry CDV26_07170       CDS       T04972                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism fha  Francisella halioticida Brite KEGG Orthology (KO) [BR:fha00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:fha03032]     CDV26_07170    03036 Chromosome and associated proteins [BR:fha03036]     CDV26_07170    03400 DNA repair and recombination proteins [BR:fha03400]     CDV26_07170 DNA replication proteins [BR:fha03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     CDV26_07170 Chromosome and associated proteins [BR:fha03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     CDV26_07170 DNA repair and recombination proteins [BR:fha03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       CDV26_07170 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 HU-CCDC81_bac_2 HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  ASG68199 LinkDB All DBs Position complement(1339289..1339561) Genome browser AA seq 90 aa AA seqDB search MNKSELVSAIAKEADVTKEVAGNTLDATIDAVTKALKKGDSVTLVGFGTFQVKERSAREG RNPKTGETIQIAASKVPSFKAGKGLKDAVK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaataaaagtgaactagtgagtgctatagctaaagaagcagatgttactaaagaagtt gctggaaatactttagacgctactattgatgcggtaactaaagctcttaagaaaggcgat agcgtaacacttgtgggatttggtacctttcaagttaaagaaagaagtgctagagaaggt agaaatcctaaaacgggcgaaacaattcaaattgcagcttctaaagttccaagctttaaa gctggtaaaggtcttaaggatgcggtaaaataa

DBGET integrated database retrieval system