Francisella halioticida: CDV26_11315 Help Entry CDV26_11315       CDS       T04972                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism fha  Francisella halioticida Pathway fha01100   Metabolic pathways fha01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:fha00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CDV26_11315   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CDV26_11315 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding NitrOD5 Motif Other DBs NCBI-ProteinID:  ASG68886 LinkDB All DBs Position 2129558..2129806 Genome browser AA seq 82 aa AA seqDB search MEEEIKKMIIEVLNLEDITPDEIDANEALFDGGLGLDSIDGLEIGVYLKKCYNISLDVAD ENIKKHFRSVASLAKFVEKNKS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggaagaagaaataaaaaaaatgattatagaagttctaaatttagaggatataactcca gatgaaattgatgccaatgaggctctttttgatggtggattaggccttgactctatagat ggtttagaaattggtgtttatttaaaaaaatgttacaatataagccttgatgtagcagat gagaatattaaaaaacattttaggtccgtcgcatctctagcaaagtttgtagaaaaaaat aaatcttaa

DBGET integrated database retrieval system