Francisella halioticida: CDV26_11320 Help Entry CDV26_11320       CDS       T04972                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism fha  Francisella halioticida Pathway fha01100   Metabolic pathways fha01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:fha00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CDV26_11320    00074 Mycolic acid biosynthesis     CDV26_11320   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CDV26_11320 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding SID ACP_SdgA_C MID51-like_C Bac_small_YrzI NBD94 Motif Other DBs NCBI-ProteinID:  ASG68887 UniProt:  A0ABM6M1X4 LinkDB All DBs Position 2129818..2130072 Genome browser AA seq 84 aa AA seqDB search MSFSKEEIFIKLQDMLQELFEIDKGDISLESSLYEDLELDSIDAVDLIVQLQSITKRKFS PEEFKSVRTIKDVVDIISKVMESE NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgagtttttctaaagaagaaatttttattaaacttcaagatatgctacaggaattattt gaaatagataagggtgatatatctctagaatctagcctgtatgaagacttagaactagat agtatcgatgctgtcgatctaatagttcagttacaaagtattactaaacgtaaattcagc cctgaggaatttaagtctgttagaacaataaaggatgtagtcgatattatttcaaaagtt atggaatcagagtag

DBGET integrated database retrieval system