Fructilactobacillus hinvesii: M3M39_04640 Help Entry M3M39_04640       CDS       T08844                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism fhin  Fructilactobacillus hinvesii Brite KEGG Orthology (KO) [BR:fhin00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:fhin03032]     M3M39_04640    03036 Chromosome and associated proteins [BR:fhin03036]     M3M39_04640    03400 DNA repair and recombination proteins [BR:fhin03400]     M3M39_04640 DNA replication proteins [BR:fhin03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     M3M39_04640 Chromosome and associated proteins [BR:fhin03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     M3M39_04640 DNA repair and recombination proteins [BR:fhin03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       M3M39_04640 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 DUF2267 HU-CCDC81_bac_2 HU-CCDC81_euk_1 Baseplate_J Rpf1_C NA37 Motif Other DBs NCBI-ProteinID:  USS87413 LinkDB All DBs Position 931353..931628 Genome browser AA seq 91 aa AA seqDB search MANKAELVDDVAQATGLTKKDATAAMDAVFDAIQAQLAKGERVQLIGFGSFEVRERAARK GRNPQTGKEIEIPASKVPAFKPGKALKDAVK NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atggccaacaaagcagaattagtagacgatgttgcgcaagcaactggtttaactaaaaag gatgctacggcagcaatggatgctgtttttgatgcaatccaagcacaacttgcaaaaggt gaacgtgttcaattaatcggttttggtagttttgaagtgcgtgaacgtgctgcacgtaaa ggacgtaacccacaaactggtaaggaaattgaaatccctgcaagtaaagtacctgccttt aaacctggtaaagctttaaaggatgctgttaaataa

DBGET integrated database retrieval system